CX286787

Overview
NameCX286787
Unique NameCX286787
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length516
Libraries
Library NameType
Veg1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig2167 contig Ccv1_Contig2167:6..521. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CX286787 vs. ExPASy Swiss-Prot
Match: ATE1_ARATH (Arginyl-tRNA--protein transferase 1 OS=Arabidopsis thaliana GN=ATE1 PE=2 SV=2)

HSP 1 Score: 160.999 bits (406), Expect = 2.949e-39
Identity = 84/167 (50.30%), Postives = 108/167 (64.67%), Query Frame = 2
Query:   11 LLDRGWRRSGSFLYKPDMERTCCPSYTIRLRASDFAPSKEQRRVSRRMQRFLDGTVDVEKKSVELIKDPSTXXXXXXXXXXXXXXXXXXXXXXXXXXXILQFLSGQIDNAVQLCIVSGQFLSGIQLPKASVKKVSQAKRKLLVEGMENLLYTSNIAFQLAATLNRAQ 511
            L+DRGWRRSG++LYK +M++TCCP YTIRL+ASDF P+KEQ+RVSRR++RFLDG +DV+ +     +                               ++  LS  ID AVQLCI SG+F S +Q+PKASVKKV  A+RK L EG E +LYTSNIAF +AA + R Q
Sbjct:   59 LIDRGWRRSGTYLYKHEMDKTCCPPYTIRLKASDFVPTKEQQRVSRRLERFLDGKLDVQPR-----EQRGASSSGDVSDTRRKTLGAAKSEENKKVEAVMDDLSKNIDQAVQLCIRSGEFPSNMQIPKASVKKVFCARRKKLAEGTEQILYTSNIAFPIAAAIKRIQ 220          
BLAST of CX286787 vs. ExPASy Swiss-Prot
Match: ATE1_MACFA (Arginyl-tRNA--protein transferase 1 OS=Macaca fascicularis GN=ATE1 PE=2 SV=1)

HSP 1 Score: 73.1738 bits (178), Expect = 8.086e-13
Identity = 30/52 (57.69%), Postives = 39/52 (75.00%), Query Frame = 2
Query:   11 LLDRGWRRSGSFLYKPDMERTCCPSYTIRLRASDFAPSKEQRRVSRRMQRFL 166
            L+DRGWRRSG ++YKP M +TCCP YTIR R   F PSK  ++V ++M +FL
Sbjct:   50 LIDRGWRRSGKYVYKPVMNQTCCPQYTIRCRPLQFQPSKSHKKVLKKMLKFL 101          
BLAST of CX286787 vs. ExPASy Swiss-Prot
Match: ATE1_HUMAN (Arginyl-tRNA--protein transferase 1 OS=Homo sapiens GN=ATE1 PE=1 SV=2)

HSP 1 Score: 73.1738 bits (178), Expect = 8.086e-13
Identity = 30/52 (57.69%), Postives = 39/52 (75.00%), Query Frame = 2
Query:   11 LLDRGWRRSGSFLYKPDMERTCCPSYTIRLRASDFAPSKEQRRVSRRMQRFL 166
            L+DRGWRRSG ++YKP M +TCCP YTIR R   F PSK  ++V ++M +FL
Sbjct:   50 LIDRGWRRSGKYVYKPVMNQTCCPQYTIRCRPLQFQPSKSHKKVLKKMLKFL 101          
BLAST of CX286787 vs. ExPASy Swiss-Prot
Match: ATE1_MOUSE (Arginyl-tRNA--protein transferase 1 OS=Mus musculus GN=Ate1 PE=1 SV=1)

HSP 1 Score: 72.0182 bits (175), Expect = 1.801e-12
Identity = 29/52 (55.77%), Postives = 39/52 (75.00%), Query Frame = 2
Query:   11 LLDRGWRRSGSFLYKPDMERTCCPSYTIRLRASDFAPSKEQRRVSRRMQRFL 166
            L+DRGWRRSG ++YKP M++TCCP YTIR     F PSK  ++V ++M +FL
Sbjct:   50 LIDRGWRRSGKYVYKPVMDQTCCPQYTIRCHPLQFQPSKSHKKVLKKMLKFL 101          
BLAST of CX286787 vs. ExPASy Swiss-Prot
Match: ATE1_DICDI (Arginyl-tRNA--protein transferase 1 OS=Dictyostelium discoideum GN=ate1 PE=3 SV=1)

HSP 1 Score: 67.781 bits (164), Expect = 3.397e-11
Identity = 30/64 (46.88%), Postives = 43/64 (67.19%), Query Frame = 2
Query:   11 LLDRGWRRSGSFLYKPDM--ERTCCPSYTIRLRASDFAPSKEQRRVSRRMQRFLDGTVDVEKKS 196
            L+D+GWRRSG+FLYKP+   ++TCCP YTIRL  S F PSK+ +   ++   ++   +  EK S
Sbjct:   56 LIDQGWRRSGTFLYKPNNSDKKTCCPQYTIRLDTSSFKPSKDNKSTIKKFNNYILNNIIKEKDS 119          
The following BLAST results are available for this feature:
BLAST of CX286787 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 5
Match NameE-valueIdentityDescription
ATE1_ARATH2.949e-3950.30Arginyl-tRNA--protein transferase 1 OS=Arabidopsis... [more]
ATE1_MACFA8.086e-1357.69Arginyl-tRNA--protein transferase 1 OS=Macaca fasc... [more]
ATE1_HUMAN8.086e-1357.69Arginyl-tRNA--protein transferase 1 OS=Homo sapien... [more]
ATE1_MOUSE1.801e-1255.77Arginyl-tRNA--protein transferase 1 OS=Mus musculu... [more]
ATE1_DICDI3.397e-1146.88Arginyl-tRNA--protein transferase 1 OS=Dictyosteli... [more]
back to top
Properties
Property NameValue
Genbank descriptionC01001A07Rv Veg1 Citrus clementina cDNA clone C01001A07, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CX286787 ID=CX286787|Name=CX286787|organism=Citrus clementina|type=EST|length=516bp
CTCGTGCCGTCTTCTTGACCGGGGATGGAGAAGATCCGGCTCTTTCCTGT
ACAAACCTGATATGGAAAGAACATGCTGTCCATCTTATACTATCCGGCTG
AGGGCAAGTGATTTTGCCCCTTCTAAAGAGCAACGTCGAGTTTCAAGACG
AATGCAAAGGTTTTTGGATGGCACAGTGGATGTGGAAAAAAAATCAGTTG
AGTTAATAAAGGATCCAAGTACTTCTAACTGCAACAAAGTTTCAAGTTCA
GTGGAAAACAATTCCTTGTCTCATAACAATGAAGAGAACAATAAGGAAGA
AGAAATTTTGCAGTTTTTATCAGGGCAAATTGACAATGCTGTGCAGTTGT
GCATTGTGAGCGGGCAATTTCTTTCTGGTATCCAACTTCCCAAAGCGTCT
GTCAAAAAAGTGTCACAGGCAAAAAGAAAACTGCTAGTTGAAGGAATGGA
AAACCTTTTATACACCAGCAACATTGCATTCCAATTAGCAGCCACTTTAA
ATCGGGCACAGTTGGC
back to top