CX286791

Overview
NameCX286791
Unique NameCX286791
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length504
Libraries
Library NameType
Veg1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
CX286791_ssr13 microsatellite CX286791_ssr13:13..27. BLAST: Citrus ESTs to Prunus persica proteins V1
CX286791_ssr201 microsatellite CX286791_ssr201:201..218. BLAST: Citrus ESTs to Prunus persica proteins V1
Homology
BLAST of CX286791 vs. ExPASy Swiss-Prot
Match: RRP2_SPIOL (30S ribosomal protein 2, chloroplastic OS=Spinacia oleracea GN=PSRP2 PE=1 SV=1)

HSP 1 Score: 141.739 bits (356), Expect = 1.769e-33
Identity = 68/87 (78.16%), Postives = 79/87 (90.80%), Query Frame = 2
Query:  242 ARRVYIGNIPRNIDNDELTKIVQEHGAVEKAEVIYDKYTGRSRRFAFVMMKTVEDANAVIEKLNGTEIGGREIKVNITEKPLVQVDL 502
            ARR+Y+GNIPRN++NDEL  IV+EHGA+E AEV+YDKY+GRSRRF FV MKTVEDANAVIEKLN TEIGGR+IKVNITEKPL  +D+
Sbjct:   83 ARRLYVGNIPRNLNNDELRTIVEEHGAIEIAEVMYDKYSGRSRRFGFVTMKTVEDANAVIEKLNDTEIGGRKIKVNITEKPLEGMDI 169          
BLAST of CX286791 vs. ExPASy Swiss-Prot
Match: ROC3_ARATH (31 kDa ribonucleoprotein, chloroplastic OS=Arabidopsis thaliana GN=RBP31 PE=1 SV=1)

HSP 1 Score: 83.5741 bits (205), Expect = 5.717e-16
Identity = 38/80 (47.50%), Postives = 54/80 (67.50%), Query Frame = 2
Query:  242 ARRVYIGNIPRNIDNDELTKIVQEHGAVEKAEVIYDKYTGRSRRFAFVMMKTVEDANAVIEKLNGTEIGGREIKVNITEK 481
            A RVY+GN+P ++DN  L ++  EHG V +A V+YD+ TGRSR F FV M  V++ N  I  L+G  + GR I+VN+ E+
Sbjct:  243 AFRVYVGNLPWDVDNGRLEQLFSEHGKVVEARVVYDRETGRSRGFGFVTMSDVDELNEAISALDGQNLEGRAIRVNVAEE 322          
BLAST of CX286791 vs. ExPASy Swiss-Prot
Match: ROC5_NICSY (33 kDa ribonucleoprotein, chloroplastic OS=Nicotiana sylvestris PE=1 SV=1)

HSP 1 Score: 79.337 bits (194), Expect = 1.078e-14
Identity = 35/79 (44.30%), Postives = 54/79 (68.35%), Query Frame = 2
Query:  248 RVYIGNIPRNIDNDELTKIVQEHGAVEKAEVIYDKYTGRSRRFAFVMMKTVEDANAVIEKLNGTEIGGREIKVNITEKP 484
            R+Y+GN+P ++ + +L++I  E G V   E++YD+ T RSR FAFV M +VE+A   I   +G+++GGR +KVN  E P
Sbjct:  115 RLYVGNLPFSMTSSQLSEIFAEAGTVANVEIVYDRVTDRSRGFAFVTMGSVEEAKEAIRLFDGSQVGGRTVKVNFPEVP 193          
BLAST of CX286791 vs. ExPASy Swiss-Prot
Match: ROC1_ARATH (Ribonucleoprotein At2g37220, chloroplastic OS=Arabidopsis thaliana GN=At2g37220 PE=1 SV=1)

HSP 1 Score: 77.411 bits (189), Expect = 4.097e-14
Identity = 34/79 (43.04%), Postives = 52/79 (65.82%), Query Frame = 2
Query:  248 RVYIGNIPRNIDNDELTKIVQEHGAVEKAEVIYDKYTGRSRRFAFVMMKTVEDANAVIEKLNGTEIGGREIKVNITEKP 484
            ++++GN+P N+D+ +L ++ +  G VE  EVIYDK TGRSR F FV M +V +  A  ++ NG E+ GR ++VN    P
Sbjct:   92 KLFVGNLPFNVDSAQLAQLFESAGNVEMVEVIYDKITGRSRGFGFVTMSSVSEVEAAAQQFNGYELDGRPLRVNAGPPP 170          
BLAST of CX286791 vs. ExPASy Swiss-Prot
Match: ROC4_NICSY (31 kDa ribonucleoprotein, chloroplastic OS=Nicotiana sylvestris PE=1 SV=1)

HSP 1 Score: 75.485 bits (184), Expect = 1.557e-13
Identity = 35/77 (45.45%), Postives = 49/77 (63.64%), Query Frame = 2
Query:  248 RVYIGNIPRNIDNDELTKIVQEHGAVEKAEVIYDKYTGRSRRFAFVMMKTVEDANAVIEKLNGTEIGGREIKVNITE 478
            R+Y+GNIP  ID+  L ++  EHG V  A V+YD+ TGRSR F FV M +  + +  I  L+G  + GR I+VN+ E
Sbjct:  231 RIYVGNIPWGIDDARLEQLFSEHGKVVSARVVYDRETGRSRGFGFVTMASEAEMSDAIANLDGQSLDGRTIRVNVAE 307          

HSP 2 Score: 68.9366 bits (167), Expect = 1.457e-11
Identity = 30/74 (40.54%), Postives = 51/74 (68.92%), Query Frame = 2
Query:  248 RVYIGNIPRNIDNDELTKIVQEHGAVEKAEVIYDKYTGRSRRFAFVMMKTVEDANAVIEKLNGTEIGGREIKVN 469
            ++++GN+P ++D++ L ++ ++ G VE AEVIY++ T +SR F FV M TVE+A   +E  N  ++ GR + VN
Sbjct:  137 KLFVGNLPYDVDSEGLARLFEQAGVVEIAEVIYNRDTDQSRGFGFVTMSTVEEAEKAVEMYNRYDVNGRLLTVN 210          
BLAST of CX286791 vs. ExPASy Swiss-Prot
Match: ROC2_NICSY (29 kDa ribonucleoprotein B, chloroplastic OS=Nicotiana sylvestris PE=2 SV=1)

HSP 1 Score: 75.0998 bits (183), Expect = 2.033e-13
Identity = 36/79 (45.57%), Postives = 50/79 (63.29%), Query Frame = 2
Query:  248 RVYIGNIPRNIDNDELTKIVQEHGAVEKAEVIYDKYTGRSRRFAFVMMKTVEDANAVIEKLNGTEIGGREIKVNITEKP 484
            ++++GN+P ++D+  L  + +  G VE  EVIYDK TGRSR F FV M T E+  A  ++ NG EI GR I+VN    P
Sbjct:   88 KLFVGNLPFSVDSAALAGLFERAGNVEMVEVIYDKLTGRSRGFGFVTMSTKEEVEAAEQQFNGYEIDGRAIRVNAGPAP 166          

HSP 2 Score: 68.1662 bits (165), Expect = 2.486e-11
Identity = 31/80 (38.75%), Postives = 51/80 (63.75%), Query Frame = 2
Query:  242 ARRVYIGNIPRNIDNDELTKIVQEHGAVEKAEVIYDKYTGRSRRFAFVMMKTVEDANAVIEKLNGTEIGGREIKVNITEK 481
            + RVY+GN+   +D+  L ++  E G V  A+V+YD+ +GRSR F FV   + ++ N  I+ LNG ++ GR I+V+  E+
Sbjct:  206 SNRVYVGNLSWGVDDLALKELFSEQGNVVDAKVVYDRDSGRSRGFGFVTYSSSKEVNDAIDSLNGVDLDGRSIRVSAAEE 285          
BLAST of CX286791 vs. ExPASy Swiss-Prot
Match: ROC1_SPIOL (28 kDa ribonucleoprotein, chloroplastic OS=Spinacia oleracea PE=1 SV=1)

HSP 1 Score: 74.7146 bits (182), Expect = 2.656e-13
Identity = 34/74 (45.95%), Postives = 52/74 (70.27%), Query Frame = 2
Query:  248 RVYIGNIPRNIDNDELTKIVQEHGAVEKAEVIYDKYTGRSRRFAFVMMKTVEDANAVIEKLNGTEIGGREIKVN 469
            ++++GN+P ++D+++L  I    G VE AEVIY++ T RSR F FV M TVE+A   +E LNG ++ GR++ VN
Sbjct:   56 KLFVGNLPYDVDSEKLAGIFDAAGVVEIAEVIYNRETDRSRGFGFVTMSTVEEAEKAVELLNGYDMDGRQLTVN 129          

HSP 2 Score: 74.3294 bits (181), Expect = 3.468e-13
Identity = 33/78 (42.31%), Postives = 49/78 (62.82%), Query Frame = 2
Query:  248 RVYIGNIPRNIDNDELTKIVQEHGAVEKAEVIYDKYTGRSRRFAFVMMKTVEDANAVIEKLNGTEIGGREIKVNITEK 481
            RVY+GN+P ++D   L ++  EHG V  A V+ D+ TGRSR F FV M +  + N  I  L+G  + GR ++VN+ E+
Sbjct:  150 RVYVGNLPWDVDTSRLEQLFSEHGKVVSARVVSDRETGRSRGFGFVTMSSESEVNDAIAALDGQTLDGRAVRVNVAEE 227          
BLAST of CX286791 vs. ExPASy Swiss-Prot
Match: ROC2_NICPL (31 kDa ribonucleoprotein, chloroplastic OS=Nicotiana plumbaginifolia PE=2 SV=1)

HSP 1 Score: 72.7886 bits (177), Expect = 1.009e-12
Identity = 35/79 (44.30%), Postives = 50/79 (63.29%), Query Frame = 2
Query:  248 RVYIGNIPRNIDNDELTKIVQEHGAVEKAEVIYDKYTGRSRRFAFVMMKTVEDANAVIEKLNGTEIGGREIKVNITEKP 484
            ++++GN+P ++D+  L  + +  G VE  EVIYDK +GRSR F FV M T E+  A  ++ NG EI GR I+VN    P
Sbjct:   89 KLFVGNLPFSVDSAALAGLFERAGNVEIVEVIYDKLSGRSRGFGFVTMSTKEEVEAAEQQFNGYEIDGRAIRVNAGPAP 167          

HSP 2 Score: 68.5514 bits (166), Expect = 1.903e-11
Identity = 31/80 (38.75%), Postives = 51/80 (63.75%), Query Frame = 2
Query:  242 ARRVYIGNIPRNIDNDELTKIVQEHGAVEKAEVIYDKYTGRSRRFAFVMMKTVEDANAVIEKLNGTEIGGREIKVNITEK 481
            + RVY+GN+   +D+  L ++  E G V  A+V+YD+ +GRSR F FV   + ++ N  I+ LNG ++ GR I+V+  E+
Sbjct:  207 SNRVYVGNLSWGVDDLALKELFSEQGNVVDAKVVYDRDSGRSRGFGFVTYSSAKEVNDAIDSLNGIDLDGRSIRVSAAEE 286          
BLAST of CX286791 vs. ExPASy Swiss-Prot
Match: ROC2_ARATH (29 kDa ribonucleoprotein, chloroplastic OS=Arabidopsis thaliana GN=RBP29 PE=1 SV=2)

HSP 1 Score: 72.7886 bits (177), Expect = 1.009e-12
Identity = 33/79 (41.77%), Postives = 49/79 (62.03%), Query Frame = 2
Query:  248 RVYIGNIPRNIDNDELTKIVQEHGAVEKAEVIYDKYTGRSRRFAFVMMKTVEDANAVIEKLNGTEIGGREIKVNITEKP 484
            ++++GN+  N+D+ +L ++ +  G VE  EVIYDK TGRSR F FV M T  +  A  ++ NG E  GR ++VN    P
Sbjct:  100 KLFVGNLSFNVDSAQLAQLFESAGNVEMVEVIYDKVTGRSRGFGFVTMSTAAEVEAAAQQFNGYEFEGRPLRVNAGPPP 178          
BLAST of CX286791 vs. ExPASy Swiss-Prot
Match: ROC1_NICSY (29 kDa ribonucleoprotein A, chloroplastic OS=Nicotiana sylvestris PE=2 SV=1)

HSP 1 Score: 72.7886 bits (177), Expect = 1.009e-12
Identity = 33/79 (41.77%), Postives = 50/79 (63.29%), Query Frame = 2
Query:  248 RVYIGNIPRNIDNDELTKIVQEHGAVEKAEVIYDKYTGRSRRFAFVMMKTVEDANAVIEKLNGTEIGGREIKVNITEKP 484
            ++++GN+P + D+  L ++ +  G VE  EVIYDK TGRSR F FV M + E+  A  ++ NG E+ GR ++VN    P
Sbjct:   88 KIFVGNLPFSADSAALAELFERAGNVEMVEVIYDKLTGRSRGFGFVTMSSKEEVEAACQQFNGYELDGRALRVNSGPPP 166          

HSP 2 Score: 71.633 bits (174), Expect = 2.248e-12
Identity = 33/79 (41.77%), Postives = 49/79 (62.03%), Query Frame = 2
Query:  242 ARRVYIGNIPRNIDNDELTKIVQEHGAVEKAEVIYDKYTGRSRRFAFVMMKTVEDANAVIEKLNGTEIGGREIKVNITE 478
            + RVY+GN+   +D D L  +  E G V  A+V+YD+ +GRSR F FV   + E+ N  IE L+G ++ GR I+V+  E
Sbjct:  187 SNRVYVGNLAWGVDQDALETLFSEQGKVVDAKVVYDRDSGRSRGFGFVTYSSAEEVNNAIESLDGVDLNGRAIRVSPAE 265          
The following BLAST results are available for this feature:
BLAST of CX286791 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 12
Match NameE-valueIdentityDescription
RRP2_SPIOL1.769e-3378.1630S ribosomal protein 2, chloroplastic OS=Spinacia... [more]
ROC3_ARATH5.717e-1647.5031 kDa ribonucleoprotein, chloroplastic OS=Arabido... [more]
ROC5_NICSY1.078e-1444.3033 kDa ribonucleoprotein, chloroplastic OS=Nicotia... [more]
ROC1_ARATH4.097e-1443.04Ribonucleoprotein At2g37220, chloroplastic OS=Arab... [more]
ROC4_NICSY1.557e-1345.4531 kDa ribonucleoprotein, chloroplastic OS=Nicotia... [more]
ROC2_NICSY2.033e-1345.5729 kDa ribonucleoprotein B, chloroplastic OS=Nicot... [more]
ROC1_SPIOL2.656e-1345.9528 kDa ribonucleoprotein, chloroplastic OS=Spinaci... [more]
ROC2_NICPL1.009e-1244.3031 kDa ribonucleoprotein, chloroplastic OS=Nicotia... [more]
ROC2_ARATH1.009e-1241.7729 kDa ribonucleoprotein, chloroplastic OS=Arabido... [more]
ROC1_NICSY1.009e-1241.7729 kDa ribonucleoprotein A, chloroplastic OS=Nicot... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC01001A11Rv Veg1 Citrus clementina cDNA clone C01001A11, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CX286791 ID=CX286791|Name=CX286791|organism=Citrus clementina|type=EST|length=504bp
AATGACTTCATTATCATCATCATCATCTCTAATACTGTCTCAACAAAATC
TCATTTTTTCAAAAACCCACTTCACATTTCAATCAAGACAACCAATTCTT
CAAATCAGATTTCCAAAACTCTCATATTCTTTGCACAATCTCAAGACAGC
AAGCACCGAAGAATCCACTACGAGACTCTTTGCAGTAGCTGAAGAAACTA
CATCATCATCATCATCATCGGTTGACACGTCTTCAGAGTTTGCTAGGAGG
GTCTATATTGGTAACATTCCTAGAAATATTGATAATGATGAACTTACAAA
GATTGTTCAAGAACACGGCGCCGTCGAGAAAGCTGAGGTTATTTATGATA
AGTACACTGGAAGGAGTCGCCGATTTGCCTTTGTTATGATGAAAACTGTT
GAGGATGCAAATGCAGTGATTGAGAAACTGAACGGCACTGAAATTGGTGG
ACGTGAGATCAAAGTAAACATCACAGAGAAACCTTTGGTGCAAGTTGATT
TGTC
back to top