CX286800

Overview
NameCX286800
Unique NameCX286800
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length588
Libraries
Library NameType
Veg1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of CX286800 vs. ExPASy Swiss-Prot
Match: GYP7_YARLI (GTPase-activating protein GYP7 OS=Yarrowia lipolytica GN=GYP7 PE=3 SV=2)

HSP 1 Score: 96.2857 bits (238), Expect = 1.199e-19
Identity = 48/165 (29.09%), Postives = 92/165 (55.76%), Query Frame = 2
Query:    2 LSPIASVMEEDHEAFWCFAGFMKKARHNFRLDEVGIRRQLSIVSKIIKCKDNHLYRHLEQLQAEDCFFVYRMVVVLFRRELIFEQTLCLWEVIWADQAAIRAGIAKSAWGRMRLRAPPTDDLLLYAIAACVLQRRKLIIEKYSSMDEIMRECNSMAGHLDVWKLL 496
            LSP+  V+++D  AFW F+ FM++   N+  D+ G+R QL  +  +++     LY+HLE+ ++ + FF +RM++V F+REL+++  L LWEV+W D                      +   +L+   A + + + ++I+  +  DEI++  N ++  +D+ +LL
Sbjct:  523 LSPLYVVLQDDTLAFWAFSAFMERMERNYLRDQSGMRNQLLCLDHLVQFMLPSLYKHLEKTESTNLFFFFRMLLVWFKRELLWDDVLRLWEVLWTDYL--------------------SSQFVLFVCLAILDKHKDVMIDHLAGFDEILKYMNELSMTIDLDELL 667          
BLAST of CX286800 vs. ExPASy Swiss-Prot
Match: TBC15_HUMAN (TBC1 domain family member 15 OS=Homo sapiens GN=TBC1D15 PE=1 SV=2)

HSP 1 Score: 82.0333 bits (201), Expect = 2.339e-15
Identity = 46/165 (27.88%), Postives = 81/165 (49.09%), Query Frame = 2
Query:    2 LSPIASVMEEDHEAFWCFAGFMKKARHNFRLDEVGIRRQLSIVSKIIKCKDNHLYRHLEQLQAEDCFFVYRMVVVLFRRELIFEQTLCLWEVIWADQAAIRAGIAKSAWGRMRLRAPPTDDLLLYAIAACVLQRRKLIIEKYSSMDEIMRECNSMAGHLDVWKLL 496
            LSP+  VME + +AFWCFA +M +   NF     G++ QL  +S +++  D+    +LE   +   +F +R +++ F+RE  F   L LWEV+W +                     P  +  L    A +   ++ I+EK+   +EI++  N ++  +DV  +L
Sbjct:  460 LSPLLYVMENEVDAFWCFASYMDQMHQNFEEQMQGMKTQLIQLSTLLRLLDSGFCSYLESQDSGYLYFCFRWLLIRFKREFSFLDILRLWEVMWTEL--------------------PCTNFHLLLCCAILESEKQQIMEKHYGFNEILKHINELSMKIDVEDIL 604          
BLAST of CX286800 vs. ExPASy Swiss-Prot
Match: GYP7_DEBHA (GTPase-activating protein GYP7 OS=Debaryomyces hansenii GN=GYP7 PE=3 SV=2)

HSP 1 Score: 81.6481 bits (200), Expect = 3.055e-15
Identity = 40/165 (24.24%), Postives = 83/165 (50.30%), Query Frame = 2
Query:    2 LSPIASVMEEDHEAFWCFAGFMKKARHNFRLDEVGIRRQLSIVSKIIKCKDNHLYRHLEQLQAEDCFFVYRMVVVLFRRELIFEQTLCLWEVIWADQAAIRAGIAKSAWGRMRLRAPPTDDLLLYAIAACVLQRRKLIIEKYSSMDEIMRECNSMAGHLDVWKLL 496
            LSP+    +++   FW F  FM +   NF  D+ G++ Q+  ++++++     L++HLE+ ++ D +F +RM++V F+RE  +   L LWE++W D                      +    L+   A +    ++I +  S  DE+++  N ++ ++++  LL
Sbjct:  544 LSPLYVTFQDESLTFWAFVNFMDRMERNFLRDQSGMKNQMLTLNELVQFMLPDLFKHLEKCESTDLYFFFRMLLVWFKREFEWSSVLSLWEILWTDYY--------------------SGQFHLFFALAVLSDNERIIRQNLSRFDEVLKYMNDLSMNMNLNHLL 688          
BLAST of CX286800 vs. ExPASy Swiss-Prot
Match: TBC15_MOUSE (TBC1 domain family member 15 OS=Mus musculus GN=Tbc1d15 PE=1 SV=1)

HSP 1 Score: 79.7221 bits (195), Expect = 1.161e-14
Identity = 45/165 (27.27%), Postives = 80/165 (48.48%), Query Frame = 2
Query:    2 LSPIASVMEEDHEAFWCFAGFMKKARHNFRLDEVGIRRQLSIVSKIIKCKDNHLYRHLEQLQAEDCFFVYRMVVVLFRRELIFEQTLCLWEVIWADQAAIRAGIAKSAWGRMRLRAPPTDDLLLYAIAACVLQRRKLIIEKYSSMDEIMRECNSMAGHLDVWKLL 496
            LSP+  VME + +AFWCFA +M +   NF     G++ QL  +S +++  D+    +LE   +   +F +R +++ F+RE  F   L LWEV+W +                     P  +  L    A +   ++ I+ K+   +EI++  N ++  +DV  +L
Sbjct:  443 LSPLLYVMENEVDAFWCFASYMDQMHQNFEEQMQGMKTQLIQLSTLLRLLDSGFCSYLESQDSGYLYFCFRWLLIRFKREFSFLDILRLWEVMWTEL--------------------PCKNFHLLLCCAILESEKQQIMAKHYGFNEILKHINELSMKIDVEDIL 587          
BLAST of CX286800 vs. ExPASy Swiss-Prot
Match: GYP7_SCHPO (GTPase-activating protein gyp7 OS=Schizosaccharomyces pombe GN=gyp7 PE=2 SV=1)

HSP 1 Score: 77.0258 bits (188), Expect = 7.524e-14
Identity = 44/159 (27.67%), Postives = 81/159 (50.94%), Query Frame = 2
Query:    2 LSPIASVMEEDHEAFWCFAGFMKKARHNFRLDEVGIRRQLSIVSKIIKCKDNHLYRHLEQLQAEDCFFVYRMVVVLFRRELIFEQTLCLWEVIWADQAAIRAGIAKSAWGRMRLRAPPTDDLLLYAIAACVLQRRKLIIEKYSSMDEIMRECNSMAGHL 478
            L+PI     ++   FW   G MK+   NF  D+ G+ RQL  +  +I+  D  L+ HLE+  + + F  +RM+++ F+RE  +E  L LW+V++ +  +    I                  + YAIA    + R++++ + S+ DE+++  N ++G L
Sbjct:  537 LAPIYVTFNDNALTFWGMVGLMKRLHFNFLRDQSGMHRQLDTLRLLIEFMDPELFAHLEKTDSSNLFCFFRMLLIYFKREFDWEVLLKLWDVLFTNYLSYDYHI-----------------FVAYAIAE---RHREVLLNQTSAFDEVLKYFNELSGKL 675          
BLAST of CX286800 vs. ExPASy Swiss-Prot
Match: GYP7_YEAST (GTPase-activating protein GYP7 OS=Saccharomyces cerevisiae GN=GYP7 PE=1 SV=1)

HSP 1 Score: 75.8702 bits (185), Expect = 1.676e-13
Identity = 42/160 (26.25%), Postives = 75/160 (46.88%), Query Frame = 2
Query:    2 LSPIASVMEEDHEAFWCFAGFMKKARHNFRLDEVGIRRQLSIVSKIIKCKDNHLYRHLEQLQAEDCFFVYRMVVVLFRRELIFEQTLCLWEVIWADQAAIRAGIAKSAWGRMRLRAPPTDDLLLYAIAACVLQRRKLIIEKYSSMDEIMRECNSMAGHLD 481
            LSPI  +M+E+ + FWCF  FM     NF  D+ GI  Q+  + ++++     L  HL +  + + FF +RM++V F+RE   E  + +WE  W                        +    L+ + A + +  + I++  +  D+I++  N + G LD
Sbjct:  537 LSPIYVIMKEEWKTFWCFTHFMDIMERNFLRDQSGIHEQMLTLVELVQLMLPELSEHLNKCDSGNLFFCFRMLLVWFKREFEMEDIMHIWENFWTFYY--------------------SSQFQLFFMLAILQKNSQAILQHLNQFDQILKFFNELNGKLD 676          
BLAST of CX286800 vs. ExPASy Swiss-Prot
Match: GYP7_CANGA (GTPase-activating protein GYP7 OS=Candida glabrata GN=GYP7 PE=3 SV=1)

HSP 1 Score: 75.8702 bits (185), Expect = 1.676e-13
Identity = 32/96 (33.33%), Postives = 56/96 (58.33%), Query Frame = 2
Query:    2 LSPIASVMEEDHEAFWCFAGFMKKARHNFRLDEVGIRRQLSIVSKIIKCKDNHLYRHLEQLQAEDCFFVYRMVVVLFRRELIFEQTLCLWEVIWAD 289
            LSP+  ++ ++   FWCF  FM++   NF  D+ GIR Q+  ++ + +     L  HL++  + D FF +RM++V F+RE  ++    +WEV + D
Sbjct:  527 LSPLYYIIRDEETTFWCFTNFMERMERNFLRDQSGIRDQMLALTDLCQLMLPRLSAHLQKCDSSDLFFCFRMLLVWFKREFNYDDIFNIWEVFFTD 622          
BLAST of CX286800 vs. ExPASy Swiss-Prot
Match: TBC17_MOUSE (TBC1 domain family member 17 OS=Mus musculus GN=Tbc1d17 PE=2 SV=1)

HSP 1 Score: 74.7146 bits (182), Expect = 3.734e-13
Identity = 51/177 (28.81%), Postives = 82/177 (46.33%), Query Frame = 2
Query:    2 LSPIASVMEEDHEAFWCFAGFMKKARHNFRLDEVGIRRQLSIVSKIIKCKDNHLYRHLEQLQAEDCFFVYRMVVVLFRRELIFEQTLCLWEVIWADQAAIRAGIAKSAWGRMRLRAPPTDDLLLYAIAACVLQRRKLIIEKYSSMDEIMRECNSMAGHLDVWKLLDDAHDLVVTLHA 532
            LSPI  V++ + +AFWCF GFM+    NF   +  ++RQL  +  +++  D  L   L+   +    F +R +++ F+RE  F   L LWEV+W                      P  +  LL A A   ++R  L++  + S +EI++  N +   L V  +L  A  L   L A
Sbjct:  424 LSPILFVVQNEVDAFWCFCGFMELVHGNFEESQETMKRQLGQLLLLLRVLDQPLCDFLDSQDSGSLCFCFRWLLIWFKREFPFPDVLRLWEVLWTG-------------------LPGPNLHLLVACAILDMERDTLMLSGFGS-NEILKHINELTMKLSVEDVLTRAEALYRQLTA 580          
BLAST of CX286800 vs. ExPASy Swiss-Prot
Match: TBC17_HUMAN (TBC1 domain family member 17 OS=Homo sapiens GN=TBC1D17 PE=2 SV=1)

HSP 1 Score: 73.559 bits (179), Expect = 8.319e-13
Identity = 49/171 (28.65%), Postives = 81/171 (47.37%), Query Frame = 2
Query:    2 LSPIASVMEEDHEAFWCFAGFMKKARHNFRLDEVGIRRQLSIVSKIIKCKDNHLYRHLEQLQAEDCFFVYRMVVVLFRRELIFEQTLCLWEVIWADQAAIRAGIAKSAWGRMRLRAPPTDDLLLYAIAACVLQRRKLIIEKYSSMDEIMRECNSMAGHLDVWKLLDDAHDL 514
            LSPI  V++ + +AFWCF GFM+  + NF   +  ++RQL  +  +++  D  L   L+   +    F +R +++ F+RE  F   L LWEV+W                      P  +  LL A A   ++R  L++  + S +EI++  N +   L V  +L  A  L
Sbjct:  424 LSPILYVIQNEVDAFWCFCGFMELVQGNFEESQETMKRQLGRLLLLLRVLDPLLCDFLDSQDSGSLCFCFRWLLIWFKREFPFPDVLRLWEVLWTG-------------------LPGPNLHLLVACAILDMERDTLMLSGFGS-NEILKHINELTMKLSVEDVLTRAEAL 574          
BLAST of CX286800 vs. ExPASy Swiss-Prot
Match: TBC25_MOUSE (TBC1 domain family member 25 OS=Mus musculus GN=Tbc1d25 PE=2 SV=1)

HSP 1 Score: 67.0106 bits (162), Expect = 7.787e-11
Identity = 31/94 (32.98%), Postives = 54/94 (57.45%), Query Frame = 2
Query:    5 SPIASVMEEDHEAFWCFAGFMKKARHNFRLDEVGIRRQLSIVSKIIKCKDNHLYRHLEQLQAEDCFFVYRMVVVLFRRELIFEQTLCLWEVIWA 286
            SPI +VM+ +  AF CF G MK+   NF  D   +  + + +  +++  D   Y++L++  A+D FF YR +++  +RE  F+  L + EV W+
Sbjct:  393 SPILAVMDHEGHAFVCFCGIMKRLAANFHPDGRAMATKFAHLKLLLRHADPDFYQYLQEAGADDLFFCYRWLLLELKREFAFDDALRMLEVTWS 486          
The following BLAST results are available for this feature:
BLAST of CX286800 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 11
Match NameE-valueIdentityDescription
GYP7_YARLI1.199e-1929.09GTPase-activating protein GYP7 OS=Yarrowia lipolyt... [more]
TBC15_HUMAN2.339e-1527.88TBC1 domain family member 15 OS=Homo sapiens GN=TB... [more]
GYP7_DEBHA3.055e-1524.24GTPase-activating protein GYP7 OS=Debaryomyces han... [more]
TBC15_MOUSE1.161e-1427.27TBC1 domain family member 15 OS=Mus musculus GN=Tb... [more]
GYP7_SCHPO7.524e-1427.67GTPase-activating protein gyp7 OS=Schizosaccharomy... [more]
GYP7_YEAST1.676e-1326.25GTPase-activating protein GYP7 OS=Saccharomyces ce... [more]
GYP7_CANGA1.676e-1333.33GTPase-activating protein GYP7 OS=Candida glabrata... [more]
TBC17_MOUSE3.734e-1328.81TBC1 domain family member 17 OS=Mus musculus GN=Tb... [more]
TBC17_HUMAN8.319e-1328.65TBC1 domain family member 17 OS=Homo sapiens GN=TB... [more]
TBC25_MOUSE7.787e-1132.98TBC1 domain family member 25 OS=Mus musculus GN=Tb... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC01001B09Rv Veg1 Citrus clementina cDNA clone C01001B09, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CX286800 ID=CX286800|Name=CX286800|organism=Citrus clementina|type=EST|length=588bp
ACTCTCTCCAATTGCCTCGGTGATGGAGGAAGACCATGAAGCCTTCTGGT
GTTTTGCTGGTTTCATGAAAAAAGCTCGGCATAATTTCAGGCTGGATGAA
GTGGGAATAAGAAGGCAGTTGAGTATTGTTTCCAAGATAATCAAGTGCAA
GGATAATCATCTCTACAGGCACCTGGAGCAGCTTCAAGCAGAAGATTGCT
TCTTTGTGTACAGAATGGTGGTGGTTCTTTTTAGGAGGGAGCTAATTTTT
GAGCAGACACTTTGCCTCTGGGAGGTGATATGGGCAGACCAAGCAGCAAT
TCGTGCTGGAATTGCTAAATCGGCCTGGGGAAGGATGAGGCTAAGAGCCC
CTCCTACCGATGACCTATTGCTTTATGCAATTGCAGCCTGTGTACTGCAA
AGGAGGAAATTGATCATAGAGAAATATAGTAGCATGGATGAGATCATGAG
GGAATGCAACAGCATGGCTGGACATCTTGATGTTTGGAAGCTTTTAGATG
ATGCCCACGATTTGGTTGTCACTTTGCATGCCAAGATTTAAGGAATGCCT
TTGTCATTGCTCTTCAATGATTCATCTTTTCGATTATT
back to top