CX287079

Overview
NameCX287079
Unique NameCX287079
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length498
Libraries
Library NameType
Veg1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of CX287079 vs. ExPASy Swiss-Prot
Match: GLR33_ARATH (Glutamate receptor 3.3 OS=Arabidopsis thaliana GN=GLR3.3 PE=2 SV=1)

HSP 1 Score: 236.884 bits (603), Expect = 3.903e-62
Identity = 119/165 (72.12%), Postives = 134/165 (81.21%), Query Frame = 2
Query:    2 EKTVSALGRXXXXXXXXXXXXXNSSYTASLTSILTVQKLSSPIKGIDSLRSSNYPIGYQVNSFARNYLVDEFNIDESRLVPLNSPEEYAKALKDGPHKGGVAAVVDDRAYAELFLSTRCEFSIVGQEFTKNGWGFAFPRDSPLAVDISTAILKLSENGDLQRIHD 496
            E TVS LGR             NSSYTASLTSILTVQ+LSSPIKGI+SLR  + PIGYQV SFA +YL +E NI ESRLVPL +PE YAKALKDGP KGGVAA+VD+R Y ELFLS+ C + IVGQEFTK+GWGFAFPRDSPLA+D+STAIL+L+ENGDLQRIHD
Sbjct:  640 ENTVSTLGRLVLIIWLFVVLIINSSYTASLTSILTVQQLSSPIKGIESLRERDDPIGYQVGSFAESYLRNELNISESRLVPLGTPEAYAKALKDGPSKGGVAAIVDERPYVELFLSSNCAYRIVGQEFTKSGWGFAFPRDSPLAIDLSTAILELAENGDLQRIHD 804          
BLAST of CX287079 vs. ExPASy Swiss-Prot
Match: GLR36_ARATH (Glutamate receptor 3.6 OS=Arabidopsis thaliana GN=GLR3.6 PE=2 SV=1)

HSP 1 Score: 228.024 bits (580), Expect = 1.813e-59
Identity = 116/165 (70.30%), Postives = 131/165 (79.39%), Query Frame = 2
Query:    2 EKTVSALGRXXXXXXXXXXXXXNSSYTASLTSILTVQKLSSPIKGIDSLRSSNYPIGYQVNSFARNYLVDEFNIDESRLVPLNSPEEYAKALKDGPHKGGVAAVVDDRAYAELFLSTRCEFSIVGQEFTKNGWGFAFPRDSPLAVDISTAILKLSENGDLQRIHD 496
            E T S LGR             NSSYTASLTSILTV +LSSPIKGI++L++++ PIGY   SF R+YL+ E NI  SRLVPL SPEEY KAL+DGP KGGVAAVVD+RAY ELFLS RCEF IVGQEFTKNGWGFAFPR+SPLAVD+S AIL+LSENGD+QRI D
Sbjct:  630 ETTTSNLGRIVLIIWLFVVLIINSSYTASLTSILTVHQLSSPIKGIETLQTNHDPIGYPQGSFVRDYLIHELNIHVSRLVPLRSPEEYDKALRDGPGKGGVAAVVDERAYIELFLSNRCEFGIVGQEFTKNGWGFAFPRNSPLAVDVSAAILQLSENGDMQRIRD 794          
BLAST of CX287079 vs. ExPASy Swiss-Prot
Match: GLR31_ORYSJ (Glutamate receptor 3.1 OS=Oryza sativa subsp. japonica GN=GLR3.1 PE=1 SV=1)

HSP 1 Score: 207.994 bits (528), Expect = 1.942e-53
Identity = 108/165 (65.45%), Postives = 123/165 (74.55%), Query Frame = 2
Query:    2 EKTVSALGRXXXXXXXXXXXXXNSSYTASLTSILTVQKLSSPIKGIDSLRSSNYPIGYQVNSFARNYLVDEFNIDESRLVPLNSPEEYAKALKDGPHKGGVAAVVDDRAYAELFLSTRCEFSIVGQEFTKNGWGFAFPRDSPLAVDISTAILKLSENGDLQRIHD 496
            E T S LGR              SSYTASLTSILTVQ+L+SPI GIDSL +S+ PIG+QV SFA NYL  E  +  SRL  L SPEEY KAL  GP KGGVAA+VD+R Y ELFL    +F++VG EFTK+GWGFAFPRDSPL+VD+STAIL+LSENGDLQRIHD
Sbjct:  642 EDTRSTLGRFVIIIWLFVVLIIQSSYTASLTSILTVQQLTSPITGIDSLITSDVPIGFQVGSFAENYLAQELGVAHSRLKALGSPEEYKKALDLGPSKGGVAAIVDERPYIELFLYQNPKFAVVGSEFTKSGWGFAFPRDSPLSVDLSTAILELSENGDLQRIHD 806          
BLAST of CX287079 vs. ExPASy Swiss-Prot
Match: GLR31_ARATH (Glutamate receptor 3.1 OS=Arabidopsis thaliana GN=GLR3.1 PE=2 SV=2)

HSP 1 Score: 201.06 bits (510), Expect = 2.374e-51
Identity = 107/165 (64.85%), Postives = 124/165 (75.15%), Query Frame = 2
Query:    2 EKTVSALGRXXXXXXXXXXXXXNSSYTASLTSILTVQKLSSPIKGIDSLRSSNYPIGYQVNSFARNYLVDEFNIDESRLVPLNSPEEYAKALKDGPHKGGVAAVVDDRAYAELFLSTRCEFSIVGQEFTKNGWGFAFPRDSPLAVDISTAILKLSENGDLQRIHD 496
            E TVS LGR              SSYTASLTSILTVQ+L+SPIKG+D+L SS   IG+QV SFA NY+ DE NI  SRLVPL SPEEYA AL++G     VAA+VD+R Y +LFLS  C+F+I GQEFT+ GWGFAFPRDSPLAVD+STAIL LSE G+LQ+IHD
Sbjct:  641 ETTVSTLGRMVLLIWLFVVLIITSSYTASLTSILTVQQLNSPIKGVDTLISSTGRIGFQVGSFAENYMTDELNIASSRLVPLASPEEYANALQNGT----VAAIVDERPYIDLFLSDYCKFAIRGQEFTRCGWGFAFPRDSPLAVDMSTAILGLSETGELQKIHD 801          
BLAST of CX287079 vs. ExPASy Swiss-Prot
Match: GLR32_ARATH (Glutamate receptor 3.2 OS=Arabidopsis thaliana GN=GLR3.2 PE=1 SV=2)

HSP 1 Score: 198.364 bits (503), Expect = 1.539e-50
Identity = 102/165 (61.82%), Postives = 125/165 (75.76%), Query Frame = 2
Query:    2 EKTVSALGRXXXXXXXXXXXXXNSSYTASLTSILTVQKLSSPIKGIDSLRSSNYPIGYQVNSFARNYLVDEFNIDESRLVPLNSPEEYAKALKDGPHKGGVAAVVDDRAYAELFLSTRCEFSIVGQEFTKNGWGFAFPRDSPLAVDISTAILKLSENGDLQRIHD 496
            E TVS LGR              SSYTASLTSILTVQ+L+SPI+G+D+L SS+  +G+QV S+A NY++DE NI  SRLVPL SP+EYA AL++G     VAA+VD+R Y +LFLS  C F+I GQEFT++GWGFAFPRDSPLA+D+STAIL LSE G LQ+IHD
Sbjct:  641 ENTVSTLGRAVLLIWLFVVLIITSSYTASLTSILTVQQLNSPIRGVDTLISSSGRVGFQVGSYAENYMIDELNIARSRLVPLGSPKEYAAALQNGT----VAAIVDERPYVDLFLSEFCGFAIRGQEFTRSGWGFAFPRDSPLAIDMSTAILGLSETGQLQKIHD 801          
BLAST of CX287079 vs. ExPASy Swiss-Prot
Match: GLR34_ARATH (Glutamate receptor 3.4 OS=Arabidopsis thaliana GN=GLR3.4 PE=2 SV=2)

HSP 1 Score: 190.274 bits (482), Expect = 4.190e-48
Identity = 98/165 (59.39%), Postives = 124/165 (75.15%), Query Frame = 2
Query:    2 EKTVSALGRXXXXXXXXXXXXXNSSYTASLTSILTVQKLSSPIKGIDSLRSSNYPIGYQVNSFARNYLVDEFNIDESRLVPLNSPEEYAKALKDGPHKGGVAAVVDDRAYAELFL-STRCEFSIVGQEFTKNGWGFAFPRDSPLAVDISTAILKLSENGDLQRIH 493
            E TVS+LGR             NSSYTASLTSILT+++L+S I+GIDSL +SN PIG Q  +FARNYL++E NI  SR+VPL   E+Y  AL+ GP+ GGVAA+VD+  Y E+ L ++ C+F  VGQEFT+ GWGFAF RDSPLAVD+STAIL+LSE G+L++IH
Sbjct:  667 ENTVSSLGRFVLIIWLFVVLIINSSYTASLTSILTIRQLTSRIEGIDSLVTSNEPIGVQDGTFARNYLINELNILPSRIVPLKDEEQYLSALQRGPNAGGVAAIVDELPYIEVLLTNSNCKFRTVGQEFTRTGWGFAFQRDSPLAVDMSTAILQLSEEGELEKIH 831          
BLAST of CX287079 vs. ExPASy Swiss-Prot
Match: GLR35_ARATH (Glutamate receptor 3.5 OS=Arabidopsis thaliana GN=GLR3.5 PE=2 SV=2)

HSP 1 Score: 177.178 bits (448), Expect = 3.670e-44
Identity = 94/164 (57.32%), Postives = 117/164 (71.34%), Query Frame = 2
Query:    2 EKTVSALGRXXXXXXXXXXXXXNSSYTASLTSILTVQKLSSPIKGIDSLRSSNYPIGYQVNSFARNYLVDEFNIDESRLVPLNSPEEYAKALKDGPHKGGVAAVVDDRAYAELFLS-TRCEFSIVGQEFTKNGWGFAFPRDSPLAVDISTAILKLSENGDLQRI 490
            E TVS LGR             NSSYTASLTSILTVQ+L+S I+G+D+L +SN PIG Q  +FA  +LV+E NI  SR++PL   EEY  AL+ GP  GGVAA+VD+  Y +  LS + C+F  VGQEFT+ GWGFAF RDSPLAVD+STAIL+L+E G L++I
Sbjct:  660 ENTVSTLGRFVLLVWLFVVLIINSSYTASLTSILTVQQLTSRIEGMDTLIASNEPIGVQDGTFAWKFLVNELNIAPSRIIPLKDEEEYLSALQRGPRGGGVAAIVDELPYIKALLSNSNCKFRTVGQEFTRTGWGFAFQRDSPLAVDMSTAILQLAEEGKLEKI 823          
BLAST of CX287079 vs. ExPASy Swiss-Prot
Match: GLR37_ARATH (Glutamate receptor 3.7 OS=Arabidopsis thaliana GN=GLR3.7 PE=2 SV=2)

HSP 1 Score: 169.088 bits (427), Expect = 9.996e-42
Identity = 94/164 (57.32%), Postives = 109/164 (66.46%), Query Frame = 2
Query:    2 EKTVSALGRXXXXXXXXXXXXXNSSYTASLTSILTVQKLSSPIKGIDSLRSSNYPIGYQVNSFARNYLVDEFNIDESRLVPLNSPEEYAKALKDGP-HKGGVAAVVDDRAYAELFLSTRCEFSIVGQEFTKNGWGFAFPRDSPLAVDISTAILKLSENGDLQRI 490
            E T+S L R              +SYTA+LTSILTVQ+L S I GIDSLR+S  PIGYQ  +F   YL     +  SRLVPL+S EEY KALK GP + GGVAA+VD+  Y ELFL+ R  F IVG+ F   GWGFAF RDSPLA+D+STAILKLSE   LQ I
Sbjct:  632 EDTISNLARLVMIVWLFLLMVLTASYTANLTSILTVQQLPSAITGIDSLRASEVPIGYQAGTFTLEYLTYSLGMARSRLVPLDSTEEYEKALKLGPTNWGGVAAIVDELPYIELFLAERTGFKIVGEPFMHRGWGFAFKRDSPLAIDMSTAILKLSETRKLQEI 795          
BLAST of CX287079 vs. ExPASy Swiss-Prot
Match: GLR25_ARATH (Glutamate receptor 2.5 OS=Arabidopsis thaliana GN=GLR2.5 PE=1 SV=2)

HSP 1 Score: 108.612 bits (270), Expect = 1.603e-23
Identity = 62/142 (43.66%), Postives = 84/142 (59.15%), Query Frame = 2
Query:   74 SYTASLTSILTVQKLSSPIKGIDSLRSSNYPIGYQVNSFARNYLVDEFNIDESRLVPLNSPEEYAKALKDGPHKGGVAAVVDDRAYAELFLSTRC-EFSIVGQEFTKNGWGFAFPRDSPLAVDISTAILKLSENGDLQRIHD 496
            SYTA+LTS+LTVQ+L   ++ +D LR S   IGYQ  SF    L  +   DESRL   NSPEE  +        GG+ A  D+ AY +LF++  C E+SI+   F  +G+GFAFP  SPL  DIS  IL ++E   ++ I +
Sbjct:  663 SYTATLTSMLTVQELRPTVRHMDDLRKSGVNIGYQTGSFTFERL-KQMRFDESRLKTYNSPEEMRELFLHKSSNGGIDAAFDEVAYIKLFMAKYCSEYSIIEPTFKADGFGFAFPLGSPLVSDISRQILNITEGDAMKAIEN 803          
BLAST of CX287079 vs. ExPASy Swiss-Prot
Match: GLR24_ARATH (Glutamate receptor 2.4 OS=Arabidopsis thaliana GN=GLR2.4 PE=2 SV=2)

HSP 1 Score: 99.7525 bits (247), Expect = 7.447e-21
Identity = 60/158 (37.97%), Postives = 85/158 (53.80%), Query Frame = 2
Query:    2 EKTVSALGRXXXXXXXXXXXXXNSSYTASLTSILTVQKLSSPIKGIDSLRSSNYPIGYQVNSFARNYLVDEFNIDESRLVPLNSPEEYAKALKDGPHKGGVAAVVDDRAYAELFLSTRC-EFSIVGQEFTKNGWGFAFPRDSPLAVDISTAILKLSEN 472
            E+ +S   R               SYTASL+S+LT Q+L+     I ++ +   P+ YQ +SF    L  E    ESRLVP  SPE+  + L  GP KGGV+A   +  Y  +FL   C ++ +V   F  +G+GF FP  SPL  D+S AILK++E+
Sbjct:  619 ERVMSFTARVVVITWYFIVLVLTQSYTASLSSLLTTQQLNPTETSIKNVLAKGGPVAYQRDSFVLGKL-RESGFPESRLVPFTSPEKCEELLNKGPSKGGVSAAFMEVPYVRVFLGQYCKKYKMVEVPFDVDGFGFVFPIGSPLVADVSRAILKVAES 775          
The following BLAST results are available for this feature:
BLAST of CX287079 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 18
Match NameE-valueIdentityDescription
GLR33_ARATH3.903e-6272.12Glutamate receptor 3.3 OS=Arabidopsis thaliana GN=... [more]
GLR36_ARATH1.813e-5970.30Glutamate receptor 3.6 OS=Arabidopsis thaliana GN=... [more]
GLR31_ORYSJ1.942e-5365.45Glutamate receptor 3.1 OS=Oryza sativa subsp. japo... [more]
GLR31_ARATH2.374e-5164.85Glutamate receptor 3.1 OS=Arabidopsis thaliana GN=... [more]
GLR32_ARATH1.539e-5061.82Glutamate receptor 3.2 OS=Arabidopsis thaliana GN=... [more]
GLR34_ARATH4.190e-4859.39Glutamate receptor 3.4 OS=Arabidopsis thaliana GN=... [more]
GLR35_ARATH3.670e-4457.32Glutamate receptor 3.5 OS=Arabidopsis thaliana GN=... [more]
GLR37_ARATH9.996e-4257.32Glutamate receptor 3.7 OS=Arabidopsis thaliana GN=... [more]
GLR25_ARATH1.603e-2343.66Glutamate receptor 2.5 OS=Arabidopsis thaliana GN=... [more]
GLR24_ARATH7.447e-2137.97Glutamate receptor 2.4 OS=Arabidopsis thaliana GN=... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC01004D12SK Veg1 Citrus clementina cDNA clone C01004D12, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CX287079 ID=CX287079|Name=CX287079|organism=Citrus clementina|type=EST|length=498bp
AGAAAAAACTGTTAGCGCACTTGGTCGCCTAGTGCTAATCATATGGCTAT
TTGTGGTTCTCATAATAAACTCAAGCTACACTGCAAGCCTAACATCAATC
CTTACAGTGCAAAAGCTATCTTCTCCCATCAAAGGCATTGATAGTTTAAG
ATCAAGCAATTATCCCATCGGTTATCAGGTGAACTCATTTGCAAGAAACT
ACTTGGTAGATGAATTCAATATTGATGAGTCAAGACTTGTACCTCTAAAT
TCACCAGAAGAGTATGCTAAAGCCTTGAAGGATGGCCCACATAAAGGCGG
TGTTGCCGCAGTGGTTGATGACCGTGCGTATGCAGAGCTCTTCCTCTCAA
CCAGATGTGAATTCAGTATTGTGGGTCAAGAGTTCACTAAAAATGGCTGG
GGTTTTGCTTTTCCTCGGGACTCGCCTTTAGCAGTTGACATATCAACCGC
CATATTGAAGCTGTCAGAGAATGGTGACCTTCAGAGGATTCATGATAA
back to top