CX287092

Overview
NameCX287092
Unique NameCX287092
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length356
Libraries
Library NameType
Veg1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of CX287092 vs. ExPASy Swiss-Prot
Match: PX115_ORYSJ (Peroxisomal membrane protein 11-5 OS=Oryza sativa subsp. japonica GN=PEX11-5 PE=2 SV=1)

HSP 1 Score: 85.8853 bits (211), Expect = 7.050e-17
Identity = 40/48 (83.33%), Postives = 46/48 (95.83%), Query Frame = -2
Query:  212 KSAMDIVVAVGLLQLAPKKVTPRVTGAFGFVTSLISCYQLLPAPVKAK 355
            KS++DIVVA+GLLQLAPKKVTPRVTGAFGF +SLI+CYQLLPAP K+K
Sbjct:  186 KSSLDIVVAIGLLQLAPKKVTPRVTGAFGFASSLIACYQLLPAPAKSK 233          
BLAST of CX287092 vs. ExPASy Swiss-Prot
Match: PX11D_ARATH (Peroxisomal membrane protein 11D OS=Arabidopsis thaliana GN=PEX11D PE=1 SV=2)

HSP 1 Score: 83.5741 bits (205), Expect = 3.499e-16
Identity = 40/50 (80.00%), Postives = 43/50 (86.00%), Query Frame = -2
Query:  206 KSAMDIVVAVGLLQLAPKKVTPRVTGAFGFVTSLISCYQLLPAPVKAKAP 355
            KSAMDIVVA GLLQLAP K+TPRVTGAFGF+TS+ISCYQLLP   K K P
Sbjct:  187 KSAMDIVVAAGLLQLAPTKITPRVTGAFGFITSIISCYQLLPTRPKIKTP 236          
BLAST of CX287092 vs. ExPASy Swiss-Prot
Match: PX11E_ARATH (Peroxisomal membrane protein 11E OS=Arabidopsis thaliana GN=PEX11E PE=1 SV=1)

HSP 1 Score: 81.6481 bits (200), Expect = 1.330e-15
Identity = 38/50 (76.00%), Postives = 44/50 (88.00%), Query Frame = -2
Query:  206 KSAMDIVVAVGLLQLAPKKVTPRVTGAFGFVTSLISCYQLLPAPVKAKAP 355
            KS+MDI+VA+GLLQLAPK ++PRVTGAFGF TSLISCYQLLP+  K K P
Sbjct:  182 KSSMDIIVAIGLLQLAPKTISPRVTGAFGFTTSLISCYQLLPSRPKLKTP 231          
BLAST of CX287092 vs. ExPASy Swiss-Prot
Match: PX111_ORYSJ (Peroxisomal membrane protein 11-1 OS=Oryza sativa subsp. japonica GN=PEX11-1 PE=2 SV=1)

HSP 1 Score: 80.1073 bits (196), Expect = 3.869e-15
Identity = 40/52 (76.92%), Postives = 46/52 (88.46%), Query Frame = -2
Query:  209 KSAMDIVVAVGLLQLAPKKVTPRVTGAFGFVTSLISCYQLLPA---PVKAKA 355
            K+AMD+VVAVGLLQL+PKK+TPRVTGAFGFVTSLISCYQ LP+    +K KA
Sbjct:  186 KAAMDVVVAVGLLQLSPKKITPRVTGAFGFVTSLISCYQQLPSRAPAIKVKA 237          
BLAST of CX287092 vs. ExPASy Swiss-Prot
Match: PX11C_ARATH (Peroxisomal membrane protein 11C OS=Arabidopsis thaliana GN=PEX11C PE=1 SV=1)

HSP 1 Score: 79.337 bits (194), Expect = 6.599e-15
Identity = 38/48 (79.17%), Postives = 43/48 (89.58%), Query Frame = -2
Query:  212 KSAMDIVVAVGLLQLAPKKVTPRVTGAFGFVTSLISCYQLLPAPVKAK 355
            K+ MD+VVA GLLQLAPKKVTPRVTGAFGF +SLISCYQLLP+  K+K
Sbjct:  186 KAGMDVVVAFGLLQLAPKKVTPRVTGAFGFASSLISCYQLLPSHPKSK 233          
The following BLAST results are available for this feature:
BLAST of CX287092 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 5
Match NameE-valueIdentityDescription
PX115_ORYSJ7.050e-1783.33Peroxisomal membrane protein 11-5 OS=Oryza sativa ... [more]
PX11D_ARATH3.499e-1680.00Peroxisomal membrane protein 11D OS=Arabidopsis th... [more]
PX11E_ARATH1.330e-1576.00Peroxisomal membrane protein 11E OS=Arabidopsis th... [more]
PX111_ORYSJ3.869e-1576.92Peroxisomal membrane protein 11-1 OS=Oryza sativa ... [more]
PX11C_ARATH6.599e-1579.17Peroxisomal membrane protein 11C OS=Arabidopsis th... [more]
back to top
Properties
Property NameValue
Genbank descriptionC01004F03SK Veg1 Citrus clementina cDNA clone C01004F03, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CX287092 ID=CX287092|Name=CX287092|organism=Citrus clementina|type=EST|length=356bp
CTTTTTTTTGAAAAGACAAGCCAGGGGTATTATTACTACTTTAAAAGAGC
AAAGTGATCTTGACGACAAGGGGAATATTTTAATGTCACCTTATAAGGTG
GCGAATTGAGCAAAAGCATACACCAACATCTGACTTATGTAACCACTACG
AATAATTATTTTAATGTCACTGAAGCTTGTGCAGCAAAGCCGCCTTCTCC
ATTCATGGGGCCTTGGCTTTTACTGGAGCTGGAAGTAGCTGATAACAAGA
GATGAGAGAGGTAACAAATCCAAAGGCTCCTGTTACACGAGGAGTAACTT
TCTTGGGGGCCAATTGAAGCAGCCCAACCGCCACCACAATGTCCATGGCT
GATTTG
back to top