CX287116

Overview
NameCX287116
Unique NameCX287116
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length576
Libraries
Library NameType
Veg1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
CX287116_ssr6 microsatellite CX287116_ssr6:6..17. BLAST: Citrus ESTs to Prunus persica proteins V1
Ccv1_Contig574 contig Ccv1_Contig574:107..682. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CX287116 vs. ExPASy Swiss-Prot
Match: H2AV3_ORYSJ (Probable histone H2A variant 3 OS=Oryza sativa subsp. japonica GN=Os03g0743400 PE=2 SV=1)

HSP 1 Score: 175.252 bits (443), Expect = 1.934e-43
Identity = 91/109 (83.49%), Postives = 94/109 (86.24%), Query Frame = 3
Query:  126 PVSRSSRAGLQFPVGRVHRLLKEXXXXXXXXXXXXXXYTAAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINKSSKE 452
            PVSRSSRAGLQFPVGR+HR LK+              Y+AAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINKSSKE
Sbjct:   29 PVSRSSRAGLQFPVGRIHRQLKQRTQANGRVGATAAVYSAAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINKSSKE 137          
BLAST of CX287116 vs. ExPASy Swiss-Prot
Match: H2AV3_ARATH (Probable histone H2A variant 3 OS=Arabidopsis thaliana GN=At1g52740 PE=1 SV=1)

HSP 1 Score: 174.096 bits (440), Expect = 4.307e-43
Identity = 90/109 (82.57%), Postives = 94/109 (86.24%), Query Frame = 3
Query:  126 PVSRSSRAGLQFPVGRVHRLLKEXXXXXXXXXXXXXXYTAAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINKSSKE 452
            P++RSSRAGLQFPVGRVHRLLK               YTAAILEYLTAEVLELAGNASKDLKVKRI+PRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINKS+KE
Sbjct:   26 PITRSSRAGLQFPVGRVHRLLKTRSTAHGRVGATAAVYTAAILEYLTAEVLELAGNASKDLKVKRISPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINKSAKE 134          
BLAST of CX287116 vs. ExPASy Swiss-Prot
Match: H2AV1_ORYSJ (Probable histone H2A variant 1 OS=Oryza sativa subsp. japonica GN=Os03g0162200 PE=2 SV=1)

HSP 1 Score: 173.326 bits (438), Expect = 7.347e-43
Identity = 90/109 (82.57%), Postives = 93/109 (85.32%), Query Frame = 3
Query:  126 PVSRSSRAGLQFPVGRVHRLLKEXXXXXXXXXXXXXXYTAAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINKSSKE 452
            PVSRSSRAGLQFPVGR+HR LK               Y+AAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINK+SKE
Sbjct:   30 PVSRSSRAGLQFPVGRIHRQLKSRASAHGRVGATAAVYSAAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINKTSKE 138          
BLAST of CX287116 vs. ExPASy Swiss-Prot
Match: H2AV2_ORYSJ (Probable histone H2A variant 2 OS=Oryza sativa subsp. japonica GN=Os10g0418000 PE=2 SV=1)

HSP 1 Score: 172.17 bits (435), Expect = 1.637e-42
Identity = 89/109 (81.65%), Postives = 93/109 (85.32%), Query Frame = 3
Query:  126 PVSRSSRAGLQFPVGRVHRLLKEXXXXXXXXXXXXXXYTAAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINKSSKE 452
            PVSRSSRAG+QFPVGR+HR LK               YTAAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINK++KE
Sbjct:   31 PVSRSSRAGIQFPVGRIHRQLKGRVSANGRVGATAAVYTAAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINKTAKE 139          
BLAST of CX287116 vs. ExPASy Swiss-Prot
Match: H2AV1_ARATH (Histone H2A variant 1 OS=Arabidopsis thaliana GN=H2AV PE=1 SV=1)

HSP 1 Score: 169.859 bits (429), Expect = 8.123e-42
Identity = 86/109 (78.90%), Postives = 93/109 (85.32%), Query Frame = 3
Query:  126 PVSRSSRAGLQFPVGRVHRLLKEXXXXXXXXXXXXXXYTAAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINKSSKE 452
            P+SRS+RAG+QFPVGR+HR LK               YTA+ILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINK++KE
Sbjct:   28 PISRSARAGIQFPVGRIHRQLKTRVSAHGRVGATAAVYTASILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINKTTKE 136          
BLAST of CX287116 vs. ExPASy Swiss-Prot
Match: H2AV2_ARATH (Probable histone H2A variant 2 OS=Arabidopsis thaliana GN=At2g38810 PE=1 SV=1)

HSP 1 Score: 166.777 bits (421), Expect = 6.877e-41
Identity = 84/108 (77.78%), Postives = 92/108 (85.19%), Query Frame = 3
Query:  129 VSRSSRAGLQFPVGRVHRLLKEXXXXXXXXXXXXXXYTAAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINKSSKE 452
            +SRSSRAG+QFPVGR+HR LK+              YTA+ILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSL+NK +K+
Sbjct:   29 ISRSSRAGIQFPVGRIHRQLKQRVSAHGRVGATAAVYTASILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLVNKVTKD 136          
BLAST of CX287116 vs. ExPASy Swiss-Prot
Match: H2AZL_XENTR (Histone H2A.Z-like OS=Xenopus tropicalis GN=h2a.zl PE=2 SV=3)

HSP 1 Score: 160.229 bits (404), Expect = 6.437e-39
Identity = 82/108 (75.93%), Postives = 88/108 (81.48%), Query Frame = 3
Query:  129 VSRSSRAGLQFPVGRVHRLLKEXXXXXXXXXXXXXXYTAAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINKSSKE 452
            ++RSSRAGLQFPVGR+HRLLK               YTAAILEYLTAEVLELAGNASKDLKVKRI+PRHLQLAIRGDEELD LIK TIAGGGVIPHIHKSLI K  ++
Sbjct:   18 ITRSSRAGLQFPVGRIHRLLKNRTTSHGRVGGTAAVYTAAILEYLTAEVLELAGNASKDLKVKRISPRHLQLAIRGDEELDALIKATIAGGGVIPHIHKSLIGKKGQQ 125          
BLAST of CX287116 vs. ExPASy Swiss-Prot
Match: H2AZL_XENLA (Histone H2A.Z-like OS=Xenopus laevis GN=h2a.zl1 PE=2 SV=3)

HSP 1 Score: 160.229 bits (404), Expect = 6.437e-39
Identity = 82/108 (75.93%), Postives = 88/108 (81.48%), Query Frame = 3
Query:  129 VSRSSRAGLQFPVGRVHRLLKEXXXXXXXXXXXXXXYTAAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINKSSKE 452
            ++RSSRAGLQFPVGR+HRLLK               YTAAILEYLTAEVLELAGNASKDLKVKRI+PRHLQLAIRGDEELD LIK TIAGGGVIPHIHKSLI K  ++
Sbjct:   18 ITRSSRAGLQFPVGRIHRLLKNRTTSHGRVGGTAAVYTAAILEYLTAEVLELAGNASKDLKVKRISPRHLQLAIRGDEELDALIKATIAGGGVIPHIHKSLIGKKGQQ 125          
BLAST of CX287116 vs. ExPASy Swiss-Prot
Match: H2AZ_SHEEP (Histone H2A.Z OS=Ovis aries GN=H2AFZ PE=2 SV=3)

HSP 1 Score: 157.918 bits (398), Expect = 3.194e-38
Identity = 82/108 (75.93%), Postives = 87/108 (80.56%), Query Frame = 3
Query:  129 VSRSSRAGLQFPVGRVHRLLKEXXXXXXXXXXXXXXYTAAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINKSSKE 452
            VSRS RAGLQFPVGR+HR LK               Y+AAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELD+LIK TIAGGGVIPHIHKSLI K  ++
Sbjct:   18 VSRSQRAGLQFPVGRIHRHLKSRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDSLIKATIAGGGVIPHIHKSLIGKKGQQ 125          
BLAST of CX287116 vs. ExPASy Swiss-Prot
Match: H2AZ_RAT (Histone H2A.Z OS=Rattus norvegicus GN=H2afz PE=1 SV=2)

HSP 1 Score: 157.918 bits (398), Expect = 3.194e-38
Identity = 82/108 (75.93%), Postives = 87/108 (80.56%), Query Frame = 3
Query:  129 VSRSSRAGLQFPVGRVHRLLKEXXXXXXXXXXXXXXYTAAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINKSSKE 452
            VSRS RAGLQFPVGR+HR LK               Y+AAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELD+LIK TIAGGGVIPHIHKSLI K  ++
Sbjct:   18 VSRSQRAGLQFPVGRIHRHLKSRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDSLIKATIAGGGVIPHIHKSLIGKKGQQ 125          
The following BLAST results are available for this feature:
BLAST of CX287116 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 241
Match NameE-valueIdentityDescription
H2AV3_ORYSJ1.934e-4383.49Probable histone H2A variant 3 OS=Oryza sativa sub... [more]
H2AV3_ARATH4.307e-4382.57Probable histone H2A variant 3 OS=Arabidopsis thal... [more]
H2AV1_ORYSJ7.347e-4382.57Probable histone H2A variant 1 OS=Oryza sativa sub... [more]
H2AV2_ORYSJ1.637e-4281.65Probable histone H2A variant 2 OS=Oryza sativa sub... [more]
H2AV1_ARATH8.123e-4278.90Histone H2A variant 1 OS=Arabidopsis thaliana GN=H... [more]
H2AV2_ARATH6.877e-4177.78Probable histone H2A variant 2 OS=Arabidopsis thal... [more]
H2AZL_XENTR6.437e-3975.93Histone H2A.Z-like OS=Xenopus tropicalis GN=h2a.zl... [more]
H2AZL_XENLA6.437e-3975.93Histone H2A.Z-like OS=Xenopus laevis GN=h2a.zl1 PE... [more]
H2AZ_SHEEP3.194e-3875.93Histone H2A.Z OS=Ovis aries GN=H2AFZ PE=2 SV=3[more]
H2AZ_RAT3.194e-3875.93Histone H2A.Z OS=Rattus norvegicus GN=H2afz PE=1 S... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC01004H04SK Veg1 Citrus clementina cDNA clone C01004H04, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CX287116 ID=CX287116|Name=CX287116|organism=Citrus clementina|type=EST|length=576bp
CGAGGAATTAATTAATTTAAAAGAAGCTGTAGAAATTAGGCGGGAAAATG
TCGGGCAAAGGAGCCAAAGGACTGATAACAGGCAAAACCACCATTAACAA
CAACAAGGATAAGGACAAGAAGAAACCCGTCTCCCGTTCTTCTCGTGCTG
GTCTTCAGTTCCCAGTGGGAAGGGTCCATCGTCTGCTAAAGGAAAGGGCT
GCTGCTCACGGAAGGGTTGGTGCAACAGCTGCTGTTTATACAGCAGCCAT
TTTGGAGTATCTAACTGCCGAAGTGTTGGAGTTGGCAGGGAATGCTAGCA
AGGATTTGAAGGTCAAACGTATTACTCCAAGGCATTTGCAGCTTGCTATC
CGAGGAGATGAAGAACTTGACACTCTCATTAAAGGAACCATAGCCGGTGG
AGGAGTTATTCCTCATATCCACAAGTCCCTCATCAATAAATCCTCCAAAG
AGTAGTTCGTGACACCATCATCCTCTCGGCTTTGTTTATGTGTGTACTTT
TAGCTGTGCTGAAATATCTAAATGAGAAATGATGCCAGAGATGTGTTAAT
GCTAAAAAAAAAAAAAAAAAAAAAAA
back to top