CX287117

Overview
NameCX287117
Unique NameCX287117
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length635
Libraries
Library NameType
Veg1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of CX287117 vs. ExPASy Swiss-Prot
Match: AROG_ARATH (Phospho-2-dehydro-3-deoxyheptonate aldolase 2, chloroplastic OS=Arabidopsis thaliana GN=DHS2 PE=2 SV=2)

HSP 1 Score: 395.201 bits (1014), Expect = 1.465e-109
Identity = 186/208 (89.42%), Postives = 200/208 (96.15%), Query Frame = 2
Query:   11 LGNAFLLMGGDCAESFKEFNANNIRDTFRVLLQMSVVLMFGGQMPVIKVGRMAGQFAKPRSDPFEEKNGVKLPSYRGDNVNGDAFDPQSRIPDPHRMIRAYSQSVATLNLLRAFATGGYAAMQRVAHWNLDFTDHSEQGDRYQELANRVDEAIGFMAAAGLTANHPIMTSTEFWTSHECLLLPYEQALTREDSTSGLYYDCSAHMVWV 634
            +G AF+L GGDCAESFKEFNANNIRDTFRVLLQM VVLMFGGQ+PVIKVGRMAGQFAKPRSDPFEEK+GVKLPSYRGDN+NGDAFD +SRIPDPHRM+RAY+QSVATLNLLRAFATGGYAAMQRV+ WNLDFT HSEQGDRY+ELANRVDEA+GFM AAGLT+ HPIMT+TEFWTSHECLLLPYEQALTREDSTSGLYYDCSAHM+WV
Sbjct:  105 MGQAFMLQGGDCAESFKEFNANNIRDTFRVLLQMGVVLMFGGQLPVIKVGRMAGQFAKPRSDPFEEKDGVKLPSYRGDNINGDAFDEKSRIPDPHRMVRAYTQSVATLNLLRAFATGGYAAMQRVSQWNLDFTQHSEQGDRYRELANRVDEALGFMGAAGLTSAHPIMTTTEFWTSHECLLLPYEQALTREDSTSGLYYDCSAHMLWV 312          
BLAST of CX287117 vs. ExPASy Swiss-Prot
Match: AROF_SOLLC (Phospho-2-dehydro-3-deoxyheptonate aldolase 1, chloroplastic OS=Solanum lycopersicum PE=2 SV=1)

HSP 1 Score: 385.185 bits (988), Expect = 1.516e-106
Identity = 182/208 (87.50%), Postives = 197/208 (94.71%), Query Frame = 2
Query:   11 LGNAFLLMGGDCAESFKEFNANNIRDTFRVLLQMSVVLMFGGQMPVIKVGRMAGQFAKPRSDPFEEKNGVKLPSYRGDNVNGDAFDPQSRIPDPHRMIRAYSQSVATLNLLRAFATGGYAAMQRVAHWNLDFTDHSEQGDRYQELANRVDEAIGFMAAAGLTANHPIMTSTEFWTSHECLLLPYEQALTREDSTSGLYYDCSAHMVWV 634
            LG AFLL GGDCAESFKEFNANNIRDTFR+LLQMSVVLMFGGQ+PVIKVGRMAGQFAKPRSDPFEE NGVKLPSY+GDN+NGD FD +SRIPDPHR+IRAY QS ATLNLLRAFATGGYAAMQRV  WNLDF ++SEQGDRYQELA+RVDEA+GFMAAAGLT +HPIM++T+FWTSHECLLLPYEQALTREDSTSGL+YDCSAHMVWV
Sbjct:  115 LGKAFLLQGGDCAESFKEFNANNIRDTFRILLQMSVVLMFGGQVPVIKVGRMAGQFAKPRSDPFEEINGVKLPSYKGDNINGDTFDEKSRIPDPHRLIRAYMQSAATLNLLRAFATGGYAAMQRVTEWNLDFVENSEQGDRYQELAHRVDEALGFMAAAGLTVDHPIMSTTDFWTSHECLLLPYEQALTREDSTSGLFYDCSAHMVWV 322          
BLAST of CX287117 vs. ExPASy Swiss-Prot
Match: AROG_SOLTU (Phospho-2-dehydro-3-deoxyheptonate aldolase 2, chloroplastic OS=Solanum tuberosum GN=SHKB PE=2 SV=1)

HSP 1 Score: 380.948 bits (977), Expect = 2.859e-105
Identity = 180/208 (86.54%), Postives = 195/208 (93.75%), Query Frame = 2
Query:   11 LGNAFLLMGGDCAESFKEFNANNIRDTFRVLLQMSVVLMFGGQMPVIKVGRMAGQFAKPRSDPFEEKNGVKLPSYRGDNVNGDAFDPQSRIPDPHRMIRAYSQSVATLNLLRAFATGGYAAMQRVAHWNLDFTDHSEQGDRYQELANRVDEAIGFMAAAGLTANHPIMTSTEFWTSHECLLLPYEQALTREDSTSGLYYDCSAHMVWV 634
            LG AFLL GGDCAESFKEFNANNIRDTFR+LLQMSVVLMFGGQ+PVIKVGRMAGQFAKPRSDP EE NGVKLPSY+GDN+NGD FD +SRIPDPHR+IRAY QS ATLNLLRAFATGGYAAMQRV  WNLDF ++ EQGDRYQELA+RVDEA+GFMAAAGLT +HPIM++T+FWTSHECLLLPYEQALTREDSTSGL+YDCSAHMVWV
Sbjct:  115 LGKAFLLQGGDCAESFKEFNANNIRDTFRILLQMSVVLMFGGQVPVIKVGRMAGQFAKPRSDPLEEINGVKLPSYKGDNINGDTFDEKSRIPDPHRLIRAYMQSAATLNLLRAFATGGYAAMQRVTEWNLDFVENCEQGDRYQELAHRVDEALGFMAAAGLTVDHPIMSTTDFWTSHECLLLPYEQALTREDSTSGLFYDCSAHMVWV 322          
BLAST of CX287117 vs. ExPASy Swiss-Prot
Match: AROF_TOBAC (Phospho-2-dehydro-3-deoxyheptonate aldolase 1, chloroplastic OS=Nicotiana tabacum GN=DHAPS-1 PE=2 SV=1)

HSP 1 Score: 379.793 bits (974), Expect = 6.370e-105
Identity = 180/208 (86.54%), Postives = 192/208 (92.31%), Query Frame = 2
Query:   11 LGNAFLLMGGDCAESFKEFNANNIRDTFRVLLQMSVVLMFGGQMPVIKVGRMAGQFAKPRSDPFEEKNGVKLPSYRGDNVNGDAFDPQSRIPDPHRMIRAYSQSVATLNLLRAFATGGYAAMQRVAHWNLDFTDHSEQGDRYQELANRVDEAIGFMAAAGLTANHPIMTSTEFWTSHECLLLPYEQALTREDSTSGLYYDCSAHMVWV 634
            +G AFLL GGDCAESFKEFNANNIRDTFR+LLQM  VLMFGGQMPVIKVGRMAGQFAKPRSD FEEKNGVKLPSYRGDNVNGDAFD +SR PDP R+IRAY QS ATLNLLRAFATGGYAAMQR+  WNLDFT+HSEQGDRY+ELANRVDEA+GFMAAAGLT +HPIM +TEFWTSHECLLLPYEQ+LTR DSTSGLYYDCSAH +WV
Sbjct:  143 MGRAFLLQGGDCAESFKEFNANNIRDTFRILLQMGAVLMFGGQMPVIKVGRMAGQFAKPRSDNFEEKNGVKLPSYRGDNVNGDAFDAKSRTPDPQRLIRAYCQSAATLNLLRAFATGGYAAMQRINQWNLDFTEHSEQGDRYRELANRVDEALGFMAAAGLTVDHPIMKTTEFWTSHECLLLPYEQSLTRLDSTSGLYYDCSAHFIWV 350          
BLAST of CX287117 vs. ExPASy Swiss-Prot
Match: AROF_SOLTU (Phospho-2-dehydro-3-deoxyheptonate aldolase 1, chloroplastic OS=Solanum tuberosum GN=SHKA PE=1 SV=2)

HSP 1 Score: 374.4 bits (960), Expect = 2.676e-103
Identity = 177/208 (85.10%), Postives = 191/208 (91.83%), Query Frame = 2
Query:   11 LGNAFLLMGGDCAESFKEFNANNIRDTFRVLLQMSVVLMFGGQMPVIKVGRMAGQFAKPRSDPFEEKNGVKLPSYRGDNVNGDAFDPQSRIPDPHRMIRAYSQSVATLNLLRAFATGGYAAMQRVAHWNLDFTDHSEQGDRYQELANRVDEAIGFMAAAGLTANHPIMTSTEFWTSHECLLLPYEQALTREDSTSGLYYDCSAHMVWV 634
            +G AFLL GGDCAESFKEFNANNIRDTFR+LLQM  VLMFGGQMPVIKVGRMAGQFAKPRSD FEEK+GVKLPSYRGDNVNGDAFD +SR PDP R+IRAY QS ATLNLLRAFATGGYAAMQR+  WNLDFT+HSEQGDRY+ELA+RVDEA+GFM AAGLT +HPIM +TEFWTSHECLLLPYEQ+LTR DSTSGLYYDCSAH +WV
Sbjct:  142 MGRAFLLQGGDCAESFKEFNANNIRDTFRILLQMGAVLMFGGQMPVIKVGRMAGQFAKPRSDSFEEKDGVKLPSYRGDNVNGDAFDVKSRTPDPQRLIRAYCQSAATLNLLRAFATGGYAAMQRINQWNLDFTEHSEQGDRYRELASRVDEALGFMTAAGLTMDHPIMKTTEFWTSHECLLLPYEQSLTRRDSTSGLYYDCSAHFLWV 349          
BLAST of CX287117 vs. ExPASy Swiss-Prot
Match: AROG_SOLLC (Phospho-2-dehydro-3-deoxyheptonate aldolase 2, chloroplastic OS=Solanum lycopersicum PE=2 SV=1)

HSP 1 Score: 372.474 bits (955), Expect = 1.017e-102
Identity = 176/208 (84.62%), Postives = 191/208 (91.83%), Query Frame = 2
Query:   11 LGNAFLLMGGDCAESFKEFNANNIRDTFRVLLQMSVVLMFGGQMPVIKVGRMAGQFAKPRSDPFEEKNGVKLPSYRGDNVNGDAFDPQSRIPDPHRMIRAYSQSVATLNLLRAFATGGYAAMQRVAHWNLDFTDHSEQGDRYQELANRVDEAIGFMAAAGLTANHPIMTSTEFWTSHECLLLPYEQALTREDSTSGLYYDCSAHMVWV 634
            +G AFLL GGDCAESFKEFNANNIRDTFR+LLQM  VLMFGGQMPVIKVGRMAGQFAKPRSD FEEK+GVKLPSYRGDNVNGDAFD +SR PDP R+IRAY QS ATLNLLRAFATGGYAAMQR+  WNLDFT+HSEQGDRY+ELA+RVDEA+GFM AAGLT +HPIM +TEFWTSHECLLLPYEQ+LTR DSTSGL+YDCSAH +WV
Sbjct:  142 MGRAFLLQGGDCAESFKEFNANNIRDTFRILLQMGAVLMFGGQMPVIKVGRMAGQFAKPRSDSFEEKDGVKLPSYRGDNVNGDAFDVKSRTPDPQRLIRAYCQSAATLNLLRAFATGGYAAMQRINQWNLDFTEHSEQGDRYRELASRVDEALGFMTAAGLTMDHPIMKTTEFWTSHECLLLPYEQSLTRRDSTSGLHYDCSAHFLWV 349          
BLAST of CX287117 vs. ExPASy Swiss-Prot
Match: AROF_ORYSJ (Phospho-2-dehydro-3-deoxyheptonate aldolase 1, chloroplastic OS=Oryza sativa subsp. japonica GN=DAHPS1 PE=2 SV=2)

HSP 1 Score: 371.318 bits (952), Expect = 2.265e-102
Identity = 173/208 (83.17%), Postives = 194/208 (93.27%), Query Frame = 2
Query:   11 LGNAFLLMGGDCAESFKEFNANNIRDTFRVLLQMSVVLMFGGQMPVIKVGRMAGQFAKPRSDPFEEKNGVKLPSYRGDNVNGDAFDPQSRIPDPHRMIRAYSQSVATLNLLRAFATGGYAAMQRVAHWNLDFTDHSEQGDRYQELANRVDEAIGFMAAAGLTANHPIMTSTEFWTSHECLLLPYEQALTREDSTSGLYYDCSAHMVWV 634
            +G AFLL GGDCAESFKEFN NNIRDTFRVLLQMS VL FGGQMPVIKVGRMAGQFAKPRS+ FEE++GVKLPSYRGDN+NGDAF+ +SRIPDP RM+RAY+QS ATLNLLRAFATGGYAAMQRV  WNLDFT HSEQGDRY+ELA+RVDEA+GFM+AAGLT +HP+MTST+FWTSHECLLLPYEQ+LTR+DST+G +YDCSAHM+WV
Sbjct:  148 MGRAFLLQGGDCAESFKEFNGNNIRDTFRVLLQMSAVLTFGGQMPVIKVGRMAGQFAKPRSEAFEERDGVKLPSYRGDNINGDAFNEKSRIPDPQRMVRAYAQSAATLNLLRAFATGGYAAMQRVTQWNLDFTQHSEQGDRYRELAHRVDEALGFMSAAGLTVDHPLMTSTDFWTSHECLLLPYEQSLTRQDSTTGHFYDCSAHMLWV 355          
BLAST of CX287117 vs. ExPASy Swiss-Prot
Match: AROG_ORYSJ (Phospho-2-dehydro-3-deoxyheptonate aldolase 2, chloroplastic OS=Oryza sativa subsp. japonica GN=DAHPS2 PE=2 SV=1)

HSP 1 Score: 370.163 bits (949), Expect = 5.047e-102
Identity = 176/210 (83.81%), Postives = 195/210 (92.86%), Query Frame = 2
Query:   11 LGNAFLLMGGDCAESFKEFNANNIRDTFRVLLQMSVVLMFGGQMPVIKV-GRMAGQFAKPRSDPFEEKNGVKLPSYRGDNVNGDAFDPQSRIPDPHRMIRAYSQSVATLNLLRAFATGGYAAMQRVAHWNLDFTDHSEQGD-RYQELANRVDEAIGFMAAAGLTANHPIMTSTEFWTSHECLLLPYEQALTREDSTSGLYYDCSAHMVWV 634
            +G AF+L GGDCAESFKEFNANNIRDTFR+LLQM  VLMFGGQMPV+KV GRMAGQFAKPRSD FEE++GVKLPSYRGDN+NGD FD +SR+PDP RMIRAY+QSVATLNLLRAFATGGYAAMQRV  WNLDF DHSEQGD RY+ELA+RVDEA+GFM AAGLT +HPIMT+T+FWTSHECLLLPYEQ+LTREDSTSGL+YDCSAHM+WV
Sbjct:  131 MGRAFVLQGGDCAESFKEFNANNIRDTFRILLQMGAVLMFGGQMPVVKVVGRMAGQFAKPRSDSFEERDGVKLPSYRGDNINGDTFDEKSRVPDPQRMIRAYAQSVATLNLLRAFATGGYAAMQRVTQWNLDFMDHSEQGDRRYRELAHRVDEALGFMTAAGLTVDHPIMTTTDFWTSHECLLLPYEQSLTREDSTSGLFYDCSAHMLWV 340          
BLAST of CX287117 vs. ExPASy Swiss-Prot
Match: AROF_ARATH (Phospho-2-dehydro-3-deoxyheptonate aldolase 1, chloroplastic OS=Arabidopsis thaliana GN=DHS1 PE=2 SV=2)

HSP 1 Score: 362.073 bits (928), Expect = 1.374e-99
Identity = 171/207 (82.61%), Postives = 190/207 (91.79%), Query Frame = 2
Query:   11 LGNAFLLMGGDCAESFKEFNANNIRDTFRVLLQMSVVLMFGGQMPVIKVGRMAGQFAKPRSDPFEEKNGVKLPSYRGDNVNGDAFDPQSRIPDPHRMIRAYSQSVATLNLLRAFATGGYAAMQRVAHWNLDFTDHSEQGDRYQELANRVDEAIGFMAAAGLTANHPIMTSTEFWTSHECLLLPYEQALTREDSTSGLYYDCSAHMVW 631
            +G AFLL GGDCAESFKEFNA NIRDTFRVLLQMS+VL FGGQ+PVIKVGRMAGQFAKPRSD FEEK+GVKLPSY+GDN+NGD FD +SRIPDP+RMIRAY+QS ATLNLLRAFATGGYAA+QRV  WNLDF + SEQ DRYQELANRVDEA+GFM+A GL  +HP+MT+T+F+TSHECLLLPYEQ+LTR DSTSGLYYDCSAHMVW
Sbjct:  128 VGKAFLLQGGDCAESFKEFNATNIRDTFRVLLQMSIVLTFGGQVPVIKVGRMAGQFAKPRSDAFEEKDGVKLPSYKGDNINGDTFDEKSRIPDPNRMIRAYTQSAATLNLLRAFATGGYAAIQRVTQWNLDFVEQSEQADRYQELANRVDEALGFMSACGLGTDHPLMTTTDFYTSHECLLLPYEQSLTRLDSTSGLYYDCSAHMVW 334          
BLAST of CX287117 vs. ExPASy Swiss-Prot
Match: AROF_STRCO (Phospho-2-dehydro-3-deoxyheptonate aldolase OS=Streptomyces coelicolor GN=aroH PE=1 SV=3)

HSP 1 Score: 225.713 bits (574), Expect = 1.537e-58
Identity = 110/207 (53.14%), Postives = 143/207 (69.08%), Query Frame = 2
Query:   14 GNAFLLMGGDCAESFKEFNANNIRDTFRVLLQMSVVLMFGGQMPVIKVGRMAGQFAKPRSDPFEEKNGVKLPSYRGDNVNGDAFDPQSRIPDPHRMIRAYSQSVATLNLLRAFATGGYAAMQRVAHWNLDFTDHSEQGDRYQELANRVDEAIGFMAAAGLTANHPIMTSTEFWTSHECLLLPYEQALTREDSTSGLYYDCSAHMVWV 634
            G AFLL GGDCAE+F   +A++IR+  + LLQM  VL +   +PV+KVGR+AGQ++KPRS P E ++GV LP+YRGD+VNG  F   +RIPDP R+ R Y  S +TLNL+RAF TGGYA +++V  WN DF   S  G RY++LA  +D A+ FM A G   +     + EF++SHE LLL YE ALTR DS +G  YD S HMVW+
Sbjct:   64 GEAFLLQGGDCAEAFDAVSADHIRNKLKTLLQMGAVLTYAASVPVVKVGRIAGQYSKPRSKPTETRDGVTLPTYRGDSVNGFDFTEAARIPDPERLKRMYHASASTLNLVRAFTTGGYADLRQVHAWNQDFVKSSPSGQRYEQLAREIDNALNFMRACG--TDPAEFQTVEFFSSHEALLLDYESALTRVDSRTGQLYDVSGHMVWI 268          
The following BLAST results are available for this feature:
BLAST of CX287117 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 14
Match NameE-valueIdentityDescription
AROG_ARATH1.465e-10989.42Phospho-2-dehydro-3-deoxyheptonate aldolase 2, chl... [more]
AROF_SOLLC1.516e-10687.50Phospho-2-dehydro-3-deoxyheptonate aldolase 1, chl... [more]
AROG_SOLTU2.859e-10586.54Phospho-2-dehydro-3-deoxyheptonate aldolase 2, chl... [more]
AROF_TOBAC6.370e-10586.54Phospho-2-dehydro-3-deoxyheptonate aldolase 1, chl... [more]
AROF_SOLTU2.676e-10385.10Phospho-2-dehydro-3-deoxyheptonate aldolase 1, chl... [more]
AROG_SOLLC1.017e-10284.62Phospho-2-dehydro-3-deoxyheptonate aldolase 2, chl... [more]
AROF_ORYSJ2.265e-10283.17Phospho-2-dehydro-3-deoxyheptonate aldolase 1, chl... [more]
AROG_ORYSJ5.047e-10283.81Phospho-2-dehydro-3-deoxyheptonate aldolase 2, chl... [more]
AROF_ARATH1.374e-9982.61Phospho-2-dehydro-3-deoxyheptonate aldolase 1, chl... [more]
AROF_STRCO1.537e-5853.14Phospho-2-dehydro-3-deoxyheptonate aldolase OS=Str... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC01004H05SK Veg1 Citrus clementina cDNA clone C01004H05, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CX287117 ID=CX287117|Name=CX287117|organism=Citrus clementina|type=EST|length=635bp
CGGCACGAGACTTGGGAACGCTTTCTTGCTTATGGGTGGAGATTGTGCTG
AGAGTTTCAAAGAATTCAATGCCAACAACATTCGTGACACCTTTCGTGTT
CTTCTTCAGATGAGTGTCGTCCTCATGTTTGGCGGCCAAATGCCTGTTAT
CAAGGTGGGGAGAATGGCGGGTCAATTTGCAAAGCCGAGGTCAGATCCAT
TTGAAGAGAAAAATGGAGTGAAGCTGCCGAGTTACAGAGGTGATAATGTG
AATGGTGATGCATTTGATCCACAATCAAGAATTCCAGACCCCCATAGAAT
GATTAGAGCCTATAGCCAATCTGTGGCAACTTTGAATCTCTTAAGGGCAT
TTGCCACGGGAGGTTATGCAGCTATGCAGAGAGTGGCCCATTGGAATCTT
GATTTCACAGATCACAGCGAACAAGGGGATAGGTACCAGGAACTGGCTAA
TCGAGTTGATGAGGCCATTGGATTTATGGCTGCTGCAGGACTCACAGCCA
ACCACCCAATCATGACTTCAACAGAGTTTTGGACATCTCATGAGTGTTTG
CTCCTGCCTTATGAACAAGCTCTCACTAGGGAGGACTCAACTTCTGGGCT
TTACTATGACTGCTCTGCTCACATGGTTTGGGTTG
back to top