CX287131

Overview
NameCX287131
Unique NameCX287131
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length548
Libraries
Library NameType
Veg1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig588 contig Ccv1_Contig588:72..619. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CX287131 vs. ExPASy Swiss-Prot
Match: RCA_MALDO (Ribulose bisphosphate carboxylase/oxygenase activase, chloroplastic OS=Malus domestica GN=RCA PE=2 SV=1)

HSP 1 Score: 237.654 bits (605), Expect = 2.867e-62
Identity = 114/151 (75.50%), Postives = 129/151 (85.43%), Query Frame = 2
Query:   95 PLSFNGSGAATSVPSSSFFGTSLKKVSSRIPPSKVPSASFKITAEVDENKQTKKDRWKGLAYDESDDQQDITRGKGAVDSLFQAPMGTGTHYAVMSSYDYISQGLRTYNLDNTMDGLYIAPAFMDKLVVHITKNFMSLPNIKVPLILGIWG 547
            P + NGS ++ SVPSS+F G+SLKKV+SR   SKV S S +I A VDE+KQT KDRWKGLA+D SDDQQDITRGKG VDSLFQAP G+GTH+A+MSSY+YIS GLR YN DN MDG YIAPAFMDKLVVHITKNFM+LPN+KVPLILGIWG
Sbjct:   15 PPNLNGSSSSASVPSSTFLGSSLKKVNSRFTNSKVSSGSLRIVASVDEDKQTDKDRWKGLAFDTSDDQQDITRGKGKVDSLFQAPQGSGTHFAIMSSYEYISTGLRQYNFDNNMDGYYIAPAFMDKLVVHITKNFMTLPNMKVPLILGIWG 165          
BLAST of CX287131 vs. ExPASy Swiss-Prot
Match: RCA2_LARTR (Ribulose bisphosphate carboxylase/oxygenase activase 2, chloroplastic OS=Larrea tridentata GN=RCA2 PE=2 SV=1)

HSP 1 Score: 233.032 bits (593), Expect = 7.061e-61
Identity = 117/153 (76.47%), Postives = 132/153 (86.27%), Query Frame = 2
Query:   95 PLSFNGSGAATS-VPSSSFFGTSLKKVSSRIPPSKVPSASFKITA-EVDENKQTKKDRWKGLAYDESDDQQDITRGKGAVDSLFQAPMGTGTHYAVMSSYDYISQGLRTYNLDNTMDGLYIAPAFMDKLVVHITKNFMSLPNIKVPLILGIWG 547
            PLS NGSGA  S VPS++FFG+SLKK +++ P  K  S +FKI A E+ E++QT KD+WKGLAYD SDDQQDITRGKG VD+LFQAPM +GTHYAVMSSYDYISQGLR YNLDN MDG YIAPAFMDKLVVHITKNF+SLPNIK+PLILGIWG
Sbjct:   15 PLSLNGSGARASLVPSTAFFGSSLKKSAAKFP--KASSGNFKIVAQEISEDQQTDKDKWKGLAYDISDDQQDITRGKGMVDTLFQAPMQSGTHYAVMSSYDYISQGLRQYNLDNNMDGFYIAPAFMDKLVVHITKNFLSLPNIKIPLILGIWG 165          
BLAST of CX287131 vs. ExPASy Swiss-Prot
Match: RCA1_LARTR (Ribulose bisphosphate carboxylase/oxygenase activase 1, chloroplastic OS=Larrea tridentata GN=RCA1 PE=2 SV=1)

HSP 1 Score: 233.032 bits (593), Expect = 7.061e-61
Identity = 117/153 (76.47%), Postives = 132/153 (86.27%), Query Frame = 2
Query:   95 PLSFNGSGAATS-VPSSSFFGTSLKKVSSRIPPSKVPSASFKITA-EVDENKQTKKDRWKGLAYDESDDQQDITRGKGAVDSLFQAPMGTGTHYAVMSSYDYISQGLRTYNLDNTMDGLYIAPAFMDKLVVHITKNFMSLPNIKVPLILGIWG 547
            PLS NGSGA  S VPS++FFG+SLKK +++ P  K  S +FKI A E+ E++QT KD+WKGLAYD SDDQQDITRGKG VD+LFQAPM +GTHYAVMSSYDYISQGLR YNLDN MDG YIAPAFMDKLVVHITKNF+SLPNIK+PLILGIWG
Sbjct:   15 PLSLNGSGARASLVPSTAFFGSSLKKSAAKFP--KASSGNFKIVAQEISEDQQTDKDKWKGLAYDISDDQQDITRGKGMVDTLFQAPMQSGTHYAVMSSYDYISQGLRQYNLDNNMDGFYIAPAFMDKLVVHITKNFLSLPNIKIPLILGIWG 165          
BLAST of CX287131 vs. ExPASy Swiss-Prot
Match: RCA_PHAAU (Ribulose bisphosphate carboxylase/oxygenase activase, chloroplastic OS=Phaseolus aureus GN=RCA PE=2 SV=2)

HSP 1 Score: 225.713 bits (574), Expect = 1.127e-58
Identity = 115/154 (74.68%), Postives = 129/154 (83.77%), Query Frame = 2
Query:   98 LSFNGSGAATSVPSSSFFGTSLKK-VSSRIPPSKVPSASFKITA---EVDENKQTKKDRWKGLAYDESDDQQDITRGKGAVDSLFQAPMGTGTHYAVMSSYDYISQGLRTYNLDNTMDGLYIAPAFMDKLVVHITKNFMSLPNIKVPLILGIWG 547
            L+ NGSGA  S P+S+FFGTSLKK V+SR+P SKV + SFKI A   E++E++QT KDRWKGLAYD SDDQQDITRGKG VD LFQAPM  GTHYAVMSSY+Y+S GLR   LDN  DG YIAPAF+DKLVVHITKNFM+LPNIKVPLILGIWG
Sbjct:   16 LNLNGSGAGASAPTSAFFGTSLKKAVASRVPNSKVTNGSFKIVAAEKEIEESQQTNKDRWKGLAYDISDDQQDITRGKGMVDPLFQAPMDAGTHYAVMSSYEYLSTGLR--QLDNIKDGFYIAPAFLDKLVVHITKNFMTLPNIKVPLILGIWG 167          
BLAST of CX287131 vs. ExPASy Swiss-Prot
Match: RCA_PHAVU (Ribulose bisphosphate carboxylase/oxygenase activase, chloroplastic OS=Phaseolus vulgaris GN=RCA1 PE=2 SV=1)

HSP 1 Score: 224.942 bits (572), Expect = 1.923e-58
Identity = 112/154 (72.73%), Postives = 127/154 (82.47%), Query Frame = 2
Query:   98 LSFNGSGAATSVPSSSFFGTSLKKV-SSRIPPSKVPSASFKITA---EVDENKQTKKDRWKGLAYDESDDQQDITRGKGAVDSLFQAPMGTGTHYAVMSSYDYISQGLRTYNLDNTMDGLYIAPAFMDKLVVHITKNFMSLPNIKVPLILGIWG 547
            L+ NGSG   S PSS+FFGTSLKKV SSR+P SK+ S SFKI A   E++E +QT+ DRW+GLAYD SDDQQDITRGKG VDSLFQAPM  GTHYAV+SS+ Y+S GLR YN DN  DG YIAPAF+DKLVVHI KNFM+LPNIKVPLILG+WG
Sbjct:   16 LNLNGSGGGASGPSSAFFGTSLKKVISSRVPNSKLTSGSFKIVAADKEIEETQQTEGDRWRGLAYDVSDDQQDITRGKGLVDSLFQAPMDAGTHYAVISSHKYLSAGLRQYNFDNIKDGFYIAPAFLDKLVVHIAKNFMTLPNIKVPLILGVWG 169          
BLAST of CX287131 vs. ExPASy Swiss-Prot
Match: RCA_ARATH (Ribulose bisphosphate carboxylase/oxygenase activase, chloroplastic OS=Arabidopsis thaliana GN=RCA PE=1 SV=2)

HSP 1 Score: 218.779 bits (556), Expect = 1.378e-56
Identity = 114/166 (68.67%), Postives = 130/166 (78.31%), Query Frame = 2
Query:   80 MAAAV---------PLSFNGSGA-ATSVPSSSFFGTSLKKVSSRIPPSKVPSASFKITAEVDENKQTKKDRWKGLAYDESDDQQDITRGKGAVDSLFQAPMGTGTHYAVMSSYDYISQGLRTYNLDNTMDGLYIAPAFMDKLVVHITKNFMSLPNIKVPLILGIWG 547
            MAAAV         PLS NGSG+ A S P+S+F G  +  VS     +K  + SFK+ A V E+KQT  DRW+GLAYD SDDQQDITRGKG VDS+FQAPMGTGTH+AV+SSY+Y+SQGLR YNLDN MDG YIAPAFMDKLVVHITKNF++LPNIKVPLILGIWG
Sbjct:    1 MAAAVSTVGAINRAPLSLNGSGSGAVSAPASTFLGKKVVTVSRFAQSNKKSNGSFKVLA-VKEDKQTDGDRWRGLAYDTSDDQQDITRGKGMVDSVFQAPMGTGTHHAVLSSYEYVSQGLRQYNLDNMMDGFYIAPAFMDKLVVHITKNFLTLPNIKVPLILGIWG 165          
BLAST of CX287131 vs. ExPASy Swiss-Prot
Match: RCA1_TOBAC (Ribulose bisphosphate carboxylase/oxygenase activase 1, chloroplastic OS=Nicotiana tabacum PE=2 SV=1)

HSP 1 Score: 218.009 bits (554), Expect = 2.351e-56
Identity = 110/155 (70.97%), Postives = 123/155 (79.35%), Query Frame = 2
Query:   95 PLSFNGSGAATSVPSSSFFGTSLKKVSSR-IPPSKVPSASFKITAE---VDENKQTKKDRWKGLAYDESDDQQDITRGKGAVDSLFQAPMGTGTHYAVMSSYDYISQGLRTYNLDNTMDGLYIAPAFMDKLVVHITKNFMSLPNIKVPLILGIWG 547
            PLS N S A TSVPS++FFG +LKKV  + +   KV + S +I AE   VD  KQT  DRWKGL  D SDDQQDITRGKG VDSLFQAP GTGTH+AV+ SY+Y+SQGLR YNLDN +DG YIAPAFMDKLVVHITKNF+ LPNIKVPLILGIWG
Sbjct:   15 PLSLNNSVAGTSVPSTAFFGKTLKKVYGKGVSSPKVTNKSLRIVAEQIDVDPKKQTDSDRWKGLVQDFSDDQQDITRGKGMVDSLFQAPTGTGTHHAVLQSYEYVSQGLRQYNLDNKLDGFYIAPAFMDKLVVHITKNFLKLPNIKVPLILGIWG 169          
BLAST of CX287131 vs. ExPASy Swiss-Prot
Match: RCA2_TOBAC (Ribulose bisphosphate carboxylase/oxygenase activase 2, chloroplastic OS=Nicotiana tabacum GN=RCA PE=2 SV=1)

HSP 1 Score: 214.542 bits (545), Expect = 2.599e-55
Identity = 107/159 (67.30%), Postives = 123/159 (77.36%), Query Frame = 2
Query:   83 AAAVPLSFNGSGAATSVPSSSFFGTSLKKVSSR-IPPSKVPSASFKITAE---VDENKQTKKDRWKGLAYDESDDQQDITRGKGAVDSLFQAPMGTGTHYAVMSSYDYISQGLRTYNLDNTMDGLYIAPAFMDKLVVHITKNFMSLPNIKVPLILGIWG 547
            A   PLS N S A TSVPS++FFG +LKKV  + +   KV + S +I AE    D  KQT  DRWKGL  D SDDQQDI RGKG VDSLFQAP GTGTH+AV+ SY+Y+SQGLR YN+DNT+DG YIAP+FMDKLVVHITKNF+ LPNIKVPLILG+WG
Sbjct:   11 ANKAPLSLNNSVAGTSVPSTAFFGKTLKKVYGKGVSSPKVTNRSLRIAAEEKDADPKKQTYSDRWKGLVQDFSDDQQDIARGKGMVDSLFQAPTGTGTHHAVLQSYEYVSQGLRQYNMDNTLDGFYIAPSFMDKLVVHITKNFLKLPNIKVPLILGVWG 169          
BLAST of CX287131 vs. ExPASy Swiss-Prot
Match: RCA_SOLPN (Ribulose bisphosphate carboxylase/oxygenase activase, chloroplastic OS=Solanum pennellii PE=2 SV=1)

HSP 1 Score: 209.149 bits (531), Expect = 1.092e-53
Identity = 105/157 (66.88%), Postives = 127/157 (80.89%), Query Frame = 2
Query:   83 AAAVPLSFNGSGAATSVPSSSFFGTSLKKVSSR-IPPSKVPSASFKITA-EVDENKQTKKDRWKGLAYDESDDQQDITRGKGAVDSLFQAPMGTGTHYAVMSSYDYISQGLRTYNLDNTMDGLYIAPAFMDKLVVHITKNFMSLPNIKVPLILGIWG 547
            A+  PLS N S A TSVPS++FFG SLKKV ++ +   KV + + ++ A EVDE   TK+DRWKGL  + SDDQQDI RGKG VDSLFQAP GTGTH+A+M+SY+Y+SQ L+TY LDN +DG YIAPAFMDKLVVHITKNF++LPNIKVPLILG+WG
Sbjct:   11 ASKAPLSLNNSVAGTSVPSTAFFGKSLKKVYAKGVSSPKVSNRNLRVVAQEVDE---TKEDRWKGLYDNTSDDQQDIARGKGLVDSLFQAPTGTGTHHAIMNSYEYVSQALKTYQLDNKLDGFYIAPAFMDKLVVHITKNFLTLPNIKVPLILGVWG 164          
BLAST of CX287131 vs. ExPASy Swiss-Prot
Match: RCA_CUCSA (Ribulose bisphosphate carboxylase/oxygenase activase, chloroplastic OS=Cucumis sativus PE=2 SV=1)

HSP 1 Score: 209.149 bits (531), Expect = 1.092e-53
Identity = 103/158 (65.19%), Postives = 122/158 (77.22%), Query Frame = 2
Query:   74 SLMAAAVPLSFNGSGAATSVPSSSFFGTSLKKVSSRIPPSKVPSASFKITAEVDENKQTKKDRWKGLAYDESDDQQDITRGKGAVDSLFQAPMGTGTHYAVMSSYDYISQGLRTYNLDNTMDGLYIAPAFMDKLVVHITKNFMSLPNIKVPLILGIWG 547
            S + A    + N S     VP+S+F G+ LK VSSR   SK+ + +FKI AE DE KQT+KD+W+GLA+D SDDQQDITRGKG  D LFQAPMGTGTH AV+SSY+YIS GLR Y+ DN +DG YIAPAFMDKL VHI KNF++LPNIKVPLILG+WG
Sbjct:    6 STIGAVNRTTLNNSNYGGLVPNSAFLGSRLK-VSSRFTTSKMVTGNFKIVAEQDEEKQTEKDKWRGLAFDTSDDQQDITRGKGLADPLFQAPMGTGTHNAVLSSYEYISAGLRDYSYDNNVDGFYIAPAFMDKLTVHIVKNFLTLPNIKVPLILGVWG 162          
The following BLAST results are available for this feature:
BLAST of CX287131 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 17
Match NameE-valueIdentityDescription
RCA_MALDO2.867e-6275.50Ribulose bisphosphate carboxylase/oxygenase activa... [more]
RCA2_LARTR7.061e-6176.47Ribulose bisphosphate carboxylase/oxygenase activa... [more]
RCA1_LARTR7.061e-6176.47Ribulose bisphosphate carboxylase/oxygenase activa... [more]
RCA_PHAAU1.127e-5874.68Ribulose bisphosphate carboxylase/oxygenase activa... [more]
RCA_PHAVU1.923e-5872.73Ribulose bisphosphate carboxylase/oxygenase activa... [more]
RCA_ARATH1.378e-5668.67Ribulose bisphosphate carboxylase/oxygenase activa... [more]
RCA1_TOBAC2.351e-5670.97Ribulose bisphosphate carboxylase/oxygenase activa... [more]
RCA2_TOBAC2.599e-5567.30Ribulose bisphosphate carboxylase/oxygenase activa... [more]
RCA_SOLPN1.092e-5366.88Ribulose bisphosphate carboxylase/oxygenase activa... [more]
RCA_CUCSA1.092e-5365.19Ribulose bisphosphate carboxylase/oxygenase activa... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC01005A09SK Veg1 Citrus clementina cDNA clone C01005A09, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CX287131 ID=CX287131|Name=CX287131|organism=Citrus clementina|type=EST|length=548bp
TGCTTCGCTTTCCTTTGCCTGCATTGCAGCGTGACCCTTTAGCTACTTCA
ATCACAGCCGTCCAATTCTCGCTAGCCTAATGGCTGCTGCTGTACCGTTG
AGCTTCAATGGCTCTGGTGCTGCAACCTCTGTCCCAAGCTCATCTTTCTT
TGGCACCAGCTTGAAGAAGGTAAGCTCAAGGATCCCCCCATCCAAGGTCC
CTTCTGCGAGCTTCAAGATTACTGCTGAAGTCGATGAGAACAAGCAGACC
AAGAAGGACAGATGGAAGGGCCTTGCCTACGACGAATCTGATGACCAACA
AGACATCACCAGAGGAAAAGGTGCTGTGGACTCTCTGTTCCAAGCCCCCA
TGGGAACCGGAACTCACTATGCTGTCATGAGTTCTTATGACTACATCAGC
CAAGGTCTCCGCACATACAACTTGGACAACACGATGGACGGTCTTTACAT
TGCCCCTGCTTTCATGGACAAGCTTGTTGTTCACATCACCAAGAACTTCA
TGTCCCTGCCCAACATCAAGGTTCCTCTCATCTTGGGTATTTGGGGAG
back to top