CX287317

Overview
NameCX287317
Unique NameCX287317
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length405
Libraries
Library NameType
Veg1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of CX287317 vs. ExPASy Swiss-Prot
Match: DYL_DICDI (Dynein light chain, cytoplasmic OS=Dictyostelium discoideum GN=dlcB PE=3 SV=1)

HSP 1 Score: 80.8777 bits (198), Expect = 2.279e-15
Identity = 39/84 (46.43%), Postives = 51/84 (60.71%), Query Frame = 2
Query:   68 VKVLACDMPGFMQVHAFRCARTTYDSLEKFSSKHIAFNIKREFDKVYGPAWHCIVGSGFGSYVTHSTGCFLYFSMEKLYILVFQ 319
            + V   DMP FMQ  A  C    ++  E    + IA  IK+EFDK Y P WHCIVG  FGS+VTH T  F+YF++ K  +L+F+
Sbjct:    8 INVKNADMPDFMQQDATECTIKAFE--ETNIERDIAMIIKKEFDKKYSPTWHCIVGKSFGSFVTHETKNFIYFNINKHSVLLFK 89          
BLAST of CX287317 vs. ExPASy Swiss-Prot
Match: DYL1_ANTCR (Dynein light chain LC6, flagellar outer arm OS=Anthocidaris crassispina PE=3 SV=1)

HSP 1 Score: 80.8777 bits (198), Expect = 2.279e-15
Identity = 42/80 (52.50%), Postives = 53/80 (66.25%), Query Frame = 2
Query:   86 DMPGFMQVHAFRCARTTYDSLEKFS-SKHIAFNIKREFDKVYGPAWHCIVGSGFGSYVTHSTGCFLYFSMEKLYILVFQT 322
            DMP  MQ  A  CA     +LEKF+  K IA  IK+EFDK Y P WHCIVG  FGSYVTH T  F+YF + ++ +L+F++
Sbjct:   12 DMPEDMQQDAVDCAT---QALEKFNIEKDIAAYIKKEFDKKYNPTWHCIVGRNFGSYVTHETKHFIYFYLGQVAVLLFKS 88          
BLAST of CX287317 vs. ExPASy Swiss-Prot
Match: DYL1_RAT (Dynein light chain 1, cytoplasmic OS=Rattus norvegicus GN=Dynll1 PE=1 SV=1)

HSP 1 Score: 77.7962 bits (190), Expect = 1.930e-14
Identity = 40/80 (50.00%), Postives = 53/80 (66.25%), Query Frame = 2
Query:   86 DMPGFMQVHAFRCARTTYDSLEKFS-SKHIAFNIKREFDKVYGPAWHCIVGSGFGSYVTHSTGCFLYFSMEKLYILVFQT 322
            DM   MQ  +  CA     +LEK++  K IA +IK+EFDK Y P WHCIVG  FGSYVTH T  F+YF + ++ IL+F++
Sbjct:   12 DMSEEMQQDSVECAT---QALEKYNIEKDIAAHIKKEFDKKYNPTWHCIVGRNFGSYVTHETKHFIYFYLGQVAILLFKS 88          
BLAST of CX287317 vs. ExPASy Swiss-Prot
Match: DYL1_RABIT (Dynein light chain 1, cytoplasmic OS=Oryctolagus cuniculus GN=DYNLL1 PE=1 SV=1)

HSP 1 Score: 77.7962 bits (190), Expect = 1.930e-14
Identity = 40/80 (50.00%), Postives = 53/80 (66.25%), Query Frame = 2
Query:   86 DMPGFMQVHAFRCARTTYDSLEKFS-SKHIAFNIKREFDKVYGPAWHCIVGSGFGSYVTHSTGCFLYFSMEKLYILVFQT 322
            DM   MQ  +  CA     +LEK++  K IA +IK+EFDK Y P WHCIVG  FGSYVTH T  F+YF + ++ IL+F++
Sbjct:   12 DMSEEMQQDSVECAT---QALEKYNIEKDIAAHIKKEFDKKYNPTWHCIVGRNFGSYVTHETKHFIYFYLGQVAILLFKS 88          
BLAST of CX287317 vs. ExPASy Swiss-Prot
Match: DYL1_MOUSE (Dynein light chain 1, cytoplasmic OS=Mus musculus GN=Dynll1 PE=1 SV=1)

HSP 1 Score: 77.7962 bits (190), Expect = 1.930e-14
Identity = 40/80 (50.00%), Postives = 53/80 (66.25%), Query Frame = 2
Query:   86 DMPGFMQVHAFRCARTTYDSLEKFS-SKHIAFNIKREFDKVYGPAWHCIVGSGFGSYVTHSTGCFLYFSMEKLYILVFQT 322
            DM   MQ  +  CA     +LEK++  K IA +IK+EFDK Y P WHCIVG  FGSYVTH T  F+YF + ++ IL+F++
Sbjct:   12 DMSEEMQQDSVECAT---QALEKYNIEKDIAAHIKKEFDKKYNPTWHCIVGRNFGSYVTHETKHFIYFYLGQVAILLFKS 88          
BLAST of CX287317 vs. ExPASy Swiss-Prot
Match: DYL1_MACFA (Dynein light chain 1, cytoplasmic OS=Macaca fascicularis GN=DYNLL1 PE=3 SV=1)

HSP 1 Score: 77.7962 bits (190), Expect = 1.930e-14
Identity = 40/80 (50.00%), Postives = 53/80 (66.25%), Query Frame = 2
Query:   86 DMPGFMQVHAFRCARTTYDSLEKFS-SKHIAFNIKREFDKVYGPAWHCIVGSGFGSYVTHSTGCFLYFSMEKLYILVFQT 322
            DM   MQ  +  CA     +LEK++  K IA +IK+EFDK Y P WHCIVG  FGSYVTH T  F+YF + ++ IL+F++
Sbjct:   12 DMSEEMQQDSVECAT---QALEKYNIEKDIAAHIKKEFDKKYNPTWHCIVGRNFGSYVTHETKHFIYFYLGQVAILLFKS 88          
BLAST of CX287317 vs. ExPASy Swiss-Prot
Match: DYL1_HUMAN (Dynein light chain 1, cytoplasmic OS=Homo sapiens GN=DYNLL1 PE=1 SV=1)

HSP 1 Score: 77.7962 bits (190), Expect = 1.930e-14
Identity = 40/80 (50.00%), Postives = 53/80 (66.25%), Query Frame = 2
Query:   86 DMPGFMQVHAFRCARTTYDSLEKFS-SKHIAFNIKREFDKVYGPAWHCIVGSGFGSYVTHSTGCFLYFSMEKLYILVFQT 322
            DM   MQ  +  CA     +LEK++  K IA +IK+EFDK Y P WHCIVG  FGSYVTH T  F+YF + ++ IL+F++
Sbjct:   12 DMSEEMQQDSVECAT---QALEKYNIEKDIAAHIKKEFDKKYNPTWHCIVGRNFGSYVTHETKHFIYFYLGQVAILLFKS 88          
BLAST of CX287317 vs. ExPASy Swiss-Prot
Match: DYL1_CAEEL (Dynein light chain 1, cytoplasmic OS=Caenorhabditis elegans GN=dlc-1 PE=1 SV=1)

HSP 1 Score: 77.7962 bits (190), Expect = 1.930e-14
Identity = 41/80 (51.25%), Postives = 52/80 (65.00%), Query Frame = 2
Query:   86 DMPGFMQVHAFRCARTTYDSLEKFS-SKHIAFNIKREFDKVYGPAWHCIVGSGFGSYVTHSTGCFLYFSMEKLYILVFQT 322
            DM   MQ  A  CA     +LEK++  K IA  IK+EFDK Y P WHCIVG  FGSYVTH T  F+YF + ++ IL+F++
Sbjct:   12 DMSDDMQQDAIDCAT---QALEKYNIEKDIAAYIKKEFDKKYNPTWHCIVGRNFGSYVTHETKHFIYFYLGQVAILLFKS 88          
BLAST of CX287317 vs. ExPASy Swiss-Prot
Match: DYL1_BOVIN (Dynein light chain 1, cytoplasmic OS=Bos taurus GN=DYNLL1 PE=3 SV=1)

HSP 1 Score: 77.7962 bits (190), Expect = 1.930e-14
Identity = 40/80 (50.00%), Postives = 53/80 (66.25%), Query Frame = 2
Query:   86 DMPGFMQVHAFRCARTTYDSLEKFS-SKHIAFNIKREFDKVYGPAWHCIVGSGFGSYVTHSTGCFLYFSMEKLYILVFQT 322
            DM   MQ  +  CA     +LEK++  K IA +IK+EFDK Y P WHCIVG  FGSYVTH T  F+YF + ++ IL+F++
Sbjct:   12 DMSEEMQQDSVECAT---QALEKYNIEKDIAAHIKKEFDKKYNPTWHCIVGRNFGSYVTHETKHFIYFYLGQVAILLFKS 88          
BLAST of CX287317 vs. ExPASy Swiss-Prot
Match: DYL1_DROME (Dynein light chain 1, cytoplasmic OS=Drosophila melanogaster GN=ctp PE=1 SV=1)

HSP 1 Score: 77.0258 bits (188), Expect = 3.291e-14
Identity = 41/80 (51.25%), Postives = 52/80 (65.00%), Query Frame = 2
Query:   86 DMPGFMQVHAFRCARTTYDSLEKFS-SKHIAFNIKREFDKVYGPAWHCIVGSGFGSYVTHSTGCFLYFSMEKLYILVFQT 322
            DM   MQ  A  CA     +LEK++  K IA  IK+EFDK Y P WHCIVG  FGSYVTH T  F+YF + ++ IL+F++
Sbjct:   12 DMSEEMQQDAVDCAT---QALEKYNIEKDIAAYIKKEFDKKYNPTWHCIVGRNFGSYVTHETRHFIYFYLGQVAILLFKS 88          
The following BLAST results are available for this feature:
BLAST of CX287317 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 22
Match NameE-valueIdentityDescription
DYL_DICDI2.279e-1546.43Dynein light chain, cytoplasmic OS=Dictyostelium d... [more]
DYL1_ANTCR2.279e-1552.50Dynein light chain LC6, flagellar outer arm OS=Ant... [more]
DYL1_RAT1.930e-1450.00Dynein light chain 1, cytoplasmic OS=Rattus norveg... [more]
DYL1_RABIT1.930e-1450.00Dynein light chain 1, cytoplasmic OS=Oryctolagus c... [more]
DYL1_MOUSE1.930e-1450.00Dynein light chain 1, cytoplasmic OS=Mus musculus ... [more]
DYL1_MACFA1.930e-1450.00Dynein light chain 1, cytoplasmic OS=Macaca fascic... [more]
DYL1_HUMAN1.930e-1450.00Dynein light chain 1, cytoplasmic OS=Homo sapiens ... [more]
DYL1_CAEEL1.930e-1451.25Dynein light chain 1, cytoplasmic OS=Caenorhabditi... [more]
DYL1_BOVIN1.930e-1450.00Dynein light chain 1, cytoplasmic OS=Bos taurus GN... [more]
DYL1_DROME3.291e-1451.25Dynein light chain 1, cytoplasmic OS=Drosophila me... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC01008B12SK Veg1 Citrus clementina cDNA clone C01008B12, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CX287317 ID=CX287317|Name=CX287317|organism=Citrus clementina|type=EST|length=405bp
GAAATCAGTGTCACACGTAGAAACCAATTTGGGAACAAACTTGGCTTCTG
TGATTTCATTTCTTCAAGTGAAGGTCTTGGCGTGTGATATGCCGGGATTC
ATGCAGGTTCATGCCTTTCGCTGTGCAAGAACCACTTATGACAGCTTGGA
GAAGTTCAGCTCCAAACACATTGCTTTTAACATTAAGAGGGAGTTCGATA
AAGTGTATGGTCCGGCTTGGCATTGCATCGTGGGTTCAGGTTTCGGATCG
TACGTGACTCATTCAACAGGTTGTTTCCTCTATTTTTCAATGGAGAAATT
GTACATTTTAGTGTTTCAAACTAAAGTTCAGAAAGCTCTAGACTCAAATT
AACTATAATATCTCCTACTATAGTTTATCGTCAAAAAAAAAAAAAAAAAA
AAAAA
back to top