CX287323

Overview
NameCX287323
Unique NameCX287323
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length412
Libraries
Library NameType
Veg1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig14839 contig Ccv1_Contig14839:132..542. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CX287323 vs. ExPASy Swiss-Prot
Match: 12KD_FRAAN (Auxin-repressed 12.5 kDa protein OS=Fragaria ananassa PE=2 SV=1)

HSP 1 Score: 65.0846 bits (157), Expect = 9.437e-13
Identity = 29/39 (74.36%), Postives = 34/39 (87.18%), Query Frame = 2
Query:  122 RKDNVWRSVFHPGSNLATRGIGAEVFDKPTHPNSPTVYD 238
            RKDNVWRSVFHPGSNL+++ +G +VFD P  PNSPTVYD
Sbjct:   61 RKDNVWRSVFHPGSNLSSKTMGNQVFDSP-QPNSPTVYD 98          

HSP 2 Score: 27.335 bits (59), Expect = 9.437e-13
Identity = 10/11 (90.91%), Postives = 11/11 (100.00%), Query Frame = 1
Query:  325 LYSGETRSKHH 357
            +YSGETRSKHH
Sbjct:  100 MYSGETRSKHH 110          
The following BLAST results are available for this feature:
BLAST of CX287323 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 1
Match NameE-valueIdentityDescription
12KD_FRAAN9.437e-1374.36Auxin-repressed 12.5 kDa protein OS=Fragaria anana... [more]
back to top
Properties
Property NameValue
Genbank descriptionC01008C08SK Veg1 Citrus clementina cDNA clone C01008C08, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CX287323 ID=CX287323|Name=CX287323|organism=Citrus clementina|type=EST|length=412bp
CTCGTGCCGAATTCGGCACGAGGCGGAGTCGTCGTCGGGCAAGTTCCAGA
GGTCTCTGTCAATGCCAGCGAGTCCAGGGGCACCGTCGACGCCAGTGACG
CCGACGACGCCGCTGTCGGCGCGTAAGGACAACGTGTGGAGGAGCGTGTT
TCACCCCGGTAGCAACCTTGCTACTAGGGGTATCGGTGCAGAGGTCTTTG
ACAAGCCCACACATCCTAACTCTCCCACTGTTTATGACTGCAACCAAATA
AAGGCTAAGAGGAAGGAGGAAAACGTGGCACTCTGTCTCATGGGCGCGTT
GAAATAGATCTTTGTCTTATTCAGCTTTACAGTGGGGAGACTAGGAGCAA
GCATCATCACTGAGTGGATGATACGCTCCAGCGATGTAAATGAATGTGAT
GGGTCACCAACT
back to top