CX287430

Overview
NameCX287430
Unique NameCX287430
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length486
Libraries
Library NameType
Veg1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig5941 contig Ccv1_Contig5941:232..717. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CX287430 vs. ExPASy Swiss-Prot
Match: HSL1_ARATH (Receptor-like protein kinase HSL1 OS=Arabidopsis thaliana GN=HSL1 PE=2 SV=1)

HSP 1 Score: 92.0485 bits (227), Expect = 1.444e-18
Identity = 57/135 (42.22%), Postives = 72/135 (53.33%), Query Frame = 3
Query:    3 LVFVPRELTGVLSPSIGRLSELRELSLANNSLVDLLPPQIVDCKKLEILNVQNNQFSGTIPSDLSSLIRLRVLDLSGNSFSGNL-GFLKYFPNLEHLSLAKNLFTGKVPTSIRTFRNLQFFDFSGNSLLEGPIPV 404
            L  V    +G +S SIG  S L  L L+NN     LP +I     L  L+   N+FSG++P  L SL  L  LDL GN FSG L   +K +  L  L+LA N FTGK+P  I +   L + D SGN +  G IPV
Sbjct:  425 LELVNNSFSGEISKSIGGASNLSLLILSNNEFTGSLPEEIGSLDNLNQLSASGNKFSGSLPDSLMSLGELGTLDLHGNQFSGELTSGIKSWKKLNELNLADNEFTGKIPDEIGSLSVLNYLDLSGN-MFSGKIPV 558          

HSP 2 Score: 78.9518 bits (193), Expect = 1.265e-14
Identity = 49/127 (38.58%), Postives = 65/127 (51.18%), Query Frame = 3
Query:   24 LTGVLSPSIGRLSELRELSLANNSLVDLLPPQIVDCKKLEILNVQNNQFSGTIPSDLSSLIRLRVLDLSGNSFSGNL-GFLKYFPNLEHLSLAKNLFTGKVPTSIRTFRNLQFFDFSGNSLLEGPIP 401
            L G     I RLS L  LSL NNS+   LP  I  CK L+ L++  N  +G +P  L+ +  L  LDL+GN+FSG++      F NLE LSL  NL  G +P  +     L+  + S N      IP
Sbjct:   72 LAGPFPSVICRLSNLAHLSLYNNSINSTLPLNIAACKSLQTLDLSQNLLTGELPQTLADIPTLVHLDLTGNNFSGDIPASFGKFENLEVLSLVYNLLDGTIPPFLGNISTLKMLNLSYNPFSPSRIP 198          

HSP 3 Score: 72.0182 bits (175), Expect = 1.546e-12
Identity = 43/128 (33.59%), Postives = 66/128 (51.56%), Query Frame = 3
Query:   21 ELTGVLSPSIGRLSELRELSLANNSLVDLLPPQIVDCKKLEILNVQNNQFSGTIPSDLSSLIRLRVLDLSGNSFSGNLG-FLKYFPNLEHLSLAKNLFTGKVPTSIRTFRNLQFFDFSGNSLLEGPIP 401
            E +G L   +    EL EL + +NS   ++P  + DC+ L  + +  N+FSG++P+    L  + +L+L  NSFSG +   +    NL  L L+ N FTG +P  I +  NL     SGN    G +P
Sbjct:  359 EFSGDLPADLCAKGELEELLIIHNSFSGVIPESLADCRSLTRIRLAYNRFSGSVPTGFWGLPHVNLLELVNNSFSGEISKSIGGASNLSLLILSNNEFTGSLPEEIGSLDNLNQLSASGNK-FSGSLP 485          

HSP 4 Score: 69.3218 bits (168), Expect = 1.002e-11
Identity = 44/123 (35.77%), Postives = 64/123 (52.03%), Query Frame = 3
Query:   24 LTGVLSPSIGRLSELRELSLANNSLVDLLPPQIVDCKKLEILNVQNNQFSGTIPSDLSSLIRLRVLDLSGNSFSGNLGFLKYFPNLEHLSLAKNLFTGKVPTSIRTFRNLQFFDFSGNSLLEG 392
            L G +  S+G+LS+L +L LA N LV  +PP +     +  + + NN  +G IP +L +L  LR+LD S N  +G +        LE L+L +N   G++P SI    NL      GN L  G
Sbjct:  217 LVGQIPDSLGQLSKLVDLDLALNDLVGHIPPSLGGLTNVVQIELYNNSLTGEIPPELGNLKSLRLLDASMNQLTGKIPDELCRVPLESLNLYENNLEGELPASIALSPNLYEIRIFGNRLTGG 339          

HSP 5 Score: 67.0106 bits (162), Expect = 4.974e-11
Identity = 46/126 (36.51%), Postives = 64/126 (50.79%), Query Frame = 3
Query:   21 ELTGVLSPSIGRLSELRELSLANNSLVDLLPPQIVDCKKLEILNVQNNQFSGTIPSDLSSLIRLRVLDLSGNSFSGNLGFLKYFPNLEHLSLAKNLFTGKVPTSIRTFRNLQFFDFSGNSLLEGPI 398
            + +G L  S+  L EL  L L  N     L   I   KKL  LN+ +N+F+G IP ++ SL  L  LDLSGN FSG +        L  L+L+ N  +G +P S+   +++    F GN  L G I
Sbjct:  479 KFSGSLPDSLMSLGELGTLDLHGNQFSGELTSGIKSWKKLNELNLADNEFTGKIPDEIGSLSVLNYLDLSGNMFSGKIPVSLQSLKLNQLNLSYNRLSGDLPPSLA--KDMYKNSFIGNPGLCGDI 602          

HSP 6 Score: 66.2402 bits (160), Expect = 8.485e-11
Identity = 41/128 (32.03%), Postives = 67/128 (52.34%), Query Frame = 3
Query:   21 ELTGVLSPSIGRLSELRELSLANNSLVDLLPPQIVDCKKLEILNVQNNQFSGTIPSDLSSLIRLRVLDLSGNSFSGNL-GFLKYFPNLEHLSLAKNLFTGKVPTSIRTFRNLQFFDFSGNSLLEGPIP 401
            +L G + PS+G L+ + ++ L NNSL   +PP++ + K L +L+   NQ +G IP +L   + L  L+L  N+  G L   +   PNL  + +  N  TG +P  +     L++ D S N    G +P
Sbjct:  240 DLVGHIPPSLGGLTNVVQIELYNNSLTGEIPPELGNLKSLRLLDASMNQLTGKIPDELCR-VPLESLNLYENNLEGELPASIALSPNLYEIRIFGNRLTGGLPKDLGLNSPLRWLDVSENE-FSGDLP 365          
BLAST of CX287430 vs. ExPASy Swiss-Prot
Match: RCH1_ARATH (LRR receptor-like serine/threonine-protein kinase RCH1 OS=Arabidopsis thaliana GN=RCH1 PE=2 SV=1)

HSP 1 Score: 91.2781 bits (225), Expect = 2.463e-18
Identity = 52/134 (38.81%), Postives = 79/134 (58.96%), Query Frame = 3
Query:    3 LVFVPRELTGVLSPSIGRLSELRELSLANNSLVDLLPPQIVDCKKLEILNVQNNQFSGTIPSDLSSLIRLRVLDLSGNSFSGNL-GFLKYFPNLEHLSLAKNLFTGKVPTSIRTFRNLQFFDFSGNSLLEGPIP 401
            L  V   +TG +   IG L  L  L L+ N+L   +P +I +C++L++LN+ NN   G +P  LSSL +L+VLD+S N  +G +   L +  +L  L L+KN F G++P+S+    NLQ  D S N+ + G IP
Sbjct:  472 LRLVNNRITGEIPKGIGFLQNLSFLDLSENNLSGPVPLEISNCRQLQMLNLSNNTLQGYLPLSLSSLTKLQVLDVSSNDLTGKIPDSLGHLISLNRLILSKNSFNGEIPSSLGHCTNLQLLDLSSNN-ISGTIP 604          

HSP 2 Score: 74.3294 bits (181), Expect = 3.116e-13
Identity = 44/127 (34.65%), Postives = 71/127 (55.91%), Query Frame = 3
Query:    3 LVFVPRELTGVLSPSIGRLSELRELSLANNSLVDLLPPQIVDCKKLEI-LNVQNNQFSGTIPSDLSSLIRLRVLDLSGNSFSGNLGFLKYFPNLEHLSLAKNLFTGKVPTSIRTFRNLQFFDFSGNS 380
            L+       G +  S+G  + L+ L L++N++   +P ++ D + L+I LN+  N   G IP  +S+L RL VLD+S N  SG+L  L    NL  L+++ N F+G +P S + FR L   +  GN+
Sbjct:  568 LILSKNSFNGEIPSSLGHCTNLQLLDLSSNNISGTIPEELFDIQDLDIALNLSWNSLDGFIPERISALNRLSVLDISHNMLSGDLSALSGLENLVSLNISHNRFSGYLPDS-KVFRQLIGAEMEGNN 693          

HSP 3 Score: 68.1662 bits (165), Expect = 2.233e-11
Identity = 44/127 (34.65%), Postives = 67/127 (52.76%), Query Frame = 3
Query:   24 LTGVLSPSIGRLSELRELSLANNSLVDLLPPQIVDCKKLEILNVQNNQFSGTIPSDLSSLIRLRVLDLSGNSFSGNLGF-LKYFPNLEHLSLAKNLFTGKVPTSIRTFRNLQFFDFSGNSLLEGPIP 401
            LTG L   + +L  L +L L +N++  ++P +I +C  L  L + NN+ +G IP  +  L  L  LDLS N+ SG +   +     L+ L+L+ N   G +P S+ +   LQ  D S N  L G IP
Sbjct:  431 LTGSLPAGLFQLRNLTKLLLISNAISGVIPLEIGNCTSLVRLRLVNNRITGEIPKGIGFLQNLSFLDLSENNLSGPVPLEISNCRQLQMLNLSNNTLQGYLPLSLSSLTKLQVLDVSSND-LTGKIP 556          
BLAST of CX287430 vs. ExPASy Swiss-Prot
Match: RCH2_ARATH (Receptor-like protein kinase 2 OS=Arabidopsis thaliana GN=RCH2 PE=1 SV=1)

HSP 1 Score: 87.8113 bits (216), Expect = 2.723e-17
Identity = 48/127 (37.80%), Postives = 74/127 (58.27%), Query Frame = 3
Query:   24 LTGVLSPSIGRLSELRELSLANNSLVDLLPPQIVDCKKLEILNVQNNQFSGTIPSDLSSLIRLRVLDLSGNSFSGNL-GFLKYFPNLEHLSLAKNLFTGKVPTSIRTFRNLQFFDFSGNSLLEGPIP 401
            +TG +   IG L ++  L  ++N L   +P +I  C +L+++++ NN   G++P+ +SSL  L+VLD+S N FSG +   L    +L  L L+KNLF+G +PTS+     LQ  D   N  L G IP
Sbjct:  478 ITGEIPSGIGSLKKINFLDFSSNRLHGKVPDEIGSCSELQMIDLSNNSLEGSLPNPVSSLSGLQVLDVSANQFSGKIPASLGRLVSLNKLILSKNLFSGSIPTSLGMCSGLQLLDLGSNE-LSGEIP 603          

HSP 2 Score: 76.2554 bits (186), Expect = 8.199e-14
Identity = 49/134 (36.57%), Postives = 70/134 (52.24%), Query Frame = 3
Query:    3 LVFVPRELTGVLSPSIGRLSELRELSLANNSLVDLLPPQIVDCKKLEILNVQNNQFSGTIPSDLSSLIRLRVLDLSGNSFSGNL-GFLKYFPNLEHLSLAKNLFTGKVPTSIRTFRNLQFFDFSGNSLLEGPIP 401
            L F    L G +   IG  SEL+ + L+NNSL   LP  +     L++L+V  NQFSG IP+ L  L+ L  L LS N FSG++   L     L+ L L  N  +G++P+ +    NL+      ++ L G IP
Sbjct:  495 LDFSSNRLHGKVPDEIGSCSELQMIDLSNNSLEGSLPNPVSSLSGLQVLDVSANQFSGKIPASLGRLVSLNKLILSKNLFSGSIPTSLGMCSGLQLLDLGSNELSGEIPSELGDIENLEIALNLSSNRLTGKIP 628          

HSP 3 Score: 75.8702 bits (185), Expect = 1.071e-13
Identity = 47/129 (36.43%), Postives = 73/129 (56.59%), Query Frame = 3
Query:    3 LVFVPRELTGVLSPSIGRLSELRELSLANNSLVDLLPPQIVDCKKLEI-LNVQNNQFSGTIPSDLSSLIRLRVLDLSGNSFSGNLGFLKYFPNLEHLSLAKNLFTGKVPTSIRTFRNLQFFDFSGNSLL 386
            L+      +G +  S+G  S L+ L L +N L   +P ++ D + LEI LN+ +N+ +G IPS ++SL +L +LDLS N   G+L  L    NL  L+++ N F+G +P + + FR L   D  GN  L
Sbjct:  567 LILSKNLFSGSIPTSLGMCSGLQLLDLGSNELSGEIPSELGDIENLEIALNLSSNRLTGKIPSKIASLNKLSILDLSHNMLEGDLAPLANIENLVSLNISYNSFSGYLPDN-KLFRQLSPQDLEGNKKL 694          

HSP 4 Score: 74.3294 bits (181), Expect = 3.116e-13
Identity = 46/134 (34.33%), Postives = 74/134 (55.22%), Query Frame = 3
Query:    3 LVFVPRELTGVLSPSIGRLSELRELSLANNSLVDLLPPQIVDCKKLEILNVQNNQFSGTIPSDLSSLIRLRVLDLSGNSFSGNL-GFLKYFPNLEHLSLAKNLFTGKVPTSIRTFRNLQFFDFSGNSLLEGPIP 401
            L      L+G +   IG+L++L +L L  NSLV  +P +I +C  L+++++  N  SG+IPS +  L  L    +S N FSG++   +    +L  L L KN  +G +P+ + T   L  F F+ ++ LEG IP
Sbjct:  279 LFLYENSLSGSIPREIGQLTKLEQLFLWQNSLVGGIPEEIGNCSNLKMIDLSLNLLSGSIPSSIGRLSFLEEFMISDNKFSGSIPTTISNCSSLVQLQLDKNQISGLIPSELGTLTKLTLF-FAWSNQLEGSIP 411          

HSP 5 Score: 71.633 bits (174), Expect = 2.019e-12
Identity = 43/128 (33.59%), Postives = 68/128 (53.12%), Query Frame = 3
Query:   21 ELTGVLSPSIGRLSELRELSLANNSLVDLLPPQIVDCKKLEILNVQNNQFSGTIPSDLSSLIRLRVLDLSGNSFSGNL-GFLKYFPNLEHLSLAKNLFTGKVPTSIRTFRNLQFFDFSGNSLLEGPIP 401
            +++G++   +G L++L      +N L   +PP + DC  L+ L++  N  +GTIPS L  L  L  L L  NS SG +   +    +L  L L  N  TG++P+ I + + + F DFS N  L G +P
Sbjct:  381 QISGLIPSELGTLTKLTLFFAWSNQLEGSIPPGLADCTDLQALDLSRNSLTGTIPSGLFMLRNLTKLLLISNSLSGFIPQEIGNCSSLVRLRLGFNRITGEIPSGIGSLKKINFLDFSSNR-LHGKVP 507          

HSP 6 Score: 69.3218 bits (168), Expect = 1.002e-11
Identity = 49/129 (37.98%), Postives = 64/129 (49.61%), Query Frame = 3
Query:   18 RELTGVLSPSIGRLSELRELSLANNSLVDLLPPQIVDCKKLEILNVQNNQFSGTIPSDLSSLIRLRVLDLSGNSFSGNL-GFLKYFPNLEHLSLAKNLFTGKVPTSIRTFRNLQFFDFSGNSLLEGPIP 401
            +E++G +   IG  S L  L LA  S+   LP  +   KKLE L++     SG IPSDL +   L  L L  NS SG++   +     LE L L +N   G +P  I    NL+  D S N LL G IP
Sbjct:  212 KEISGQIPSEIGDCSNLTVLGLAETSVSGNLPSSLGKLKKLETLSIYTTMISGEIPSDLGNCSELVDLFLYENSLSGSIPREIGQLTKLEQLFLWQNSLVGGIPEEIGNCSNLKMIDLSLN-LLSGSIP 339          
BLAST of CX287430 vs. ExPASy Swiss-Prot
Match: ERL2_ARATH (LRR receptor-like serine/threonine-protein kinase ERL2 OS=Arabidopsis thaliana GN=ERL2 PE=2 SV=1)

HSP 1 Score: 87.0409 bits (214), Expect = 4.645e-17
Identity = 50/128 (39.06%), Postives = 72/128 (56.25%), Query Frame = 3
Query:   21 ELTGVLSPSIGRLSELRELSLANNSLVDLLPPQIVDCKKLEILNVQNNQFSGTIPSDLSSLIRLRVLDLSGNSFSGNL-GFLKYFPNLEHLSLAKNLFTGKVPTSIRTFRNLQFFDFSGNSLLEGPIP 401
            EL G + P +G+L +L EL+LANN+LV L+P  I  C  L   NV  N  SG +P +  +L  L  L+LS NSF G +   L +  NL+ L L+ N F+G +P ++    +L   + S N  L G +P
Sbjct:  347 ELVGKIPPELGKLEQLFELNLANNNLVGLIPSNISSCAALNQFNVHGNFLSGAVPLEFRNLGSLTYLNLSSNSFKGKIPAELGHIINLDTLDLSGNNFSGSIPLTLGDLEHLLILNLSRNH-LNGTLP 473          

HSP 2 Score: 82.0333 bits (201), Expect = 1.494e-15
Identity = 47/129 (36.43%), Postives = 72/129 (55.81%), Query Frame = 3
Query:   21 ELTGVLSPSIGRLSELRELSLANNSLVDLLPPQIVDCKKLEILNVQNNQFSGTIPSDLSSLIRLRVLDLSGNSFSGNLGF-LKYFPNLEHLSLAKNLFTGKVPTSIRTFRNLQFFDFSGNSLLEGPIPV 404
            +LTG + P +G +S L  L L +N LV  +PP++   ++L  LN+ NN   G IPS++SS   L   ++ GN  SG +    +   +L +L+L+ N F GK+P  +    NL   D SGN+   G IP+
Sbjct:  323 KLTGQIPPELGNMSRLSYLQLNDNELVGKIPPELGKLEQLFELNLANNNLVGLIPSNISSCAALNQFNVHGNFLSGAVPLEFRNLGSLTYLNLSSNSFKGKIPAELGHIINLDTLDLSGNN-FSGSIPL 450          

HSP 3 Score: 72.0182 bits (175), Expect = 1.546e-12
Identity = 44/128 (34.38%), Postives = 68/128 (53.12%), Query Frame = 3
Query:   21 ELTGVLSPSIGRLSELRELSLANNSLVDLLPPQIVDCKKLEILNVQNNQFSGTIPSDLSSLIRLRVLDLSGNSFSGNLGFLKYFPN-LEHLSLAKNLFTGKVPTSIRTFRNLQFFDFSGNSLLEGPIP 401
            +L G +   IG    L  +  + N L   +P  I   K+LE LN++NNQ +G IP+ L+ +  L+ LDL+ N  +G +  L Y+   L++L L  N+ TG +   +     L +FD  GN+ L G IP
Sbjct:  108 KLGGQIPDEIGNCVSLAYVDFSTNLLFGDIPFSISKLKQLEFLNLKNNQLTGPIPATLTQIPNLKTLDLARNQLTGEIPRLLYWNEVLQYLGLRGNMLTGTLSPDMCQLTGLWYFDVRGNN-LTGTIP 234          
BLAST of CX287430 vs. ExPASy Swiss-Prot
Match: PSKR2_ARATH (Phytosulfokine receptor 2 OS=Arabidopsis thaliana GN=PSKR2 PE=2 SV=1)

HSP 1 Score: 85.1149 bits (209), Expect = 1.765e-16
Identity = 45/130 (34.62%), Postives = 72/130 (55.38%), Query Frame = 3
Query:    3 LVFVPRELTGVLSPSIGRLSELRELSLANNSLVDLLPPQIVDCKKLEILNVQNNQFSGTIPSDLSSLIRLRVLDLSGNSFSGNL-GFLKYFPNLEHLSLAKNLFTGKVPTSIRTFRNLQFFDFSGNSLLE 389
            L+      + V+    G L++L  L +++N      PP +  C KL +L+++NN  SG+I  + +    L VLDL+ N FSG L   L + P ++ LSLAKN F GK+P + +  ++L F   S NS ++
Sbjct:  261 LLISENRFSDVIPDVFGNLTQLEHLDVSSNKFSGRFPPSLSQCSKLRVLDLRNNSLSGSINLNFTGFTDLCVLDLASNHFSGPLPDSLGHCPKMKILSLAKNEFRGKIPDTFKNLQSLLFLSLSNNSFVD 390          

HSP 2 Score: 79.337 bits (194), Expect = 9.685e-15
Identity = 46/129 (35.66%), Postives = 76/129 (58.91%), Query Frame = 3
Query:    3 LVFVPRELTGVLSPSIGRLSELRELSLANNSLVDLLPPQIVDCKKLEILNVQNNQFSGTIPSDLSSLIRLRVLDLSGNSFSGNLGFLKYFPNLEHLSLAKNLFTGKV-PTSIRTFRNLQFFDFSGNSLL 386
            LV   + L GV+S S+G L+ELR L L+ N L   +P +I   ++L++L++ +N  SG++   +S L  ++ L++S NS SG L  +  FP L  L+++ NLF G++ P    +   +Q  D S N L+
Sbjct:   69 LVLPEKGLEGVISKSLGELTELRVLDLSRNQLKGEVPAEISKLEQLQVLDLSHNLLSGSVLGVVSGLKLIQSLNISSNSLSGKLSDVGVFPGLVMLNVSNNLFEGEIHPELCSSSGGIQVLDLSMNRLV 197          
BLAST of CX287430 vs. ExPASy Swiss-Prot
Match: Y4361_ARATH (Probable LRR receptor-like serine/threonine-protein kinase At4g36180 OS=Arabidopsis thaliana GN=At4g36180 PE=1 SV=1)

HSP 1 Score: 83.9593 bits (206), Expect = 3.932e-16
Identity = 56/150 (37.33%), Postives = 70/150 (46.67%), Query Frame = 3
Query:   27 TGVLSPSIGRLSELRELSLANNSLVDLLPPQIVDCKKLEILNVQNNQFSGTIPSDLSSLIRLRVLDLSGNSFSG---------------NLG----------FLKYFPNLEHLSLAKNLFTGKVPTSIRTFRNLQFFDFSGNSLLEGPIP 401
            +G + P IG L  L EL LANNSL   +P +I  C  L++L+ + N   G IP  L  +  L+VL L  NSFSG               NLG           L    +L  L L+ N F+G VP SI    NL F + SGN    G IP
Sbjct:  345 SGEIPPDIGNLKRLEELKLANNSLTGEIPVEIKQCGSLDVLDFEGNSLKGQIPEFLGYMKALKVLSLGRNSFSGYVPSSMVNLQQLERLNLGENNLNGSFPVELMALTSLSELDLSGNRFSGAVPVSISNLSNLSFLNLSGNG-FSGEIP 493          

HSP 2 Score: 78.9518 bits (193), Expect = 1.265e-14
Identity = 51/138 (36.96%), Postives = 75/138 (54.35%), Query Frame = 3
Query:   27 TGVLSPSIGRLSELRELSLANNSLVDLLPPQIVDCKKLEILNVQNNQFSGTIPSDLSSLIRLRVLDLSGNSFSGNL-GFLKYFPNLEHLSLAKNLFTGKVPTSIRTFRNLQFFDFSGNSLLEGPIPVMRRVGPSGFQY 437
            +G +  + G L  L  LSL++N +   +PP+I +C  LE+L +++N+  G IP+DLS L RL+VLDL  N+ SG +   +    +L  LSL  N  +G +P S     NL   D S N+ L G IP    +  S   Y
Sbjct:  561 SGEIPQTFGFLRLLVSLSLSDNHISGSIPPEIGNCSALEVLELRSNRLMGHIPADLSRLPRLKVLDLGQNNLSGEIPPEISQSSSLNSLSLDHNHLSGVIPGSFSGLSNLTKMDLSVNN-LTGEIPASLALISSNLVY 697          

HSP 3 Score: 76.2554 bits (186), Expect = 8.199e-14
Identity = 47/135 (34.81%), Postives = 72/135 (53.33%), Query Frame = 3
Query:    3 LVFVPRELTGVLSPSIGRLSELRELSLANNSLVDLLPPQIVDCKKLEILNVQNNQFSGTIPSDLSSLIRLRVLDLSGNSFSGNLGF-LKYFPNLEHLSLAKNLFTGKVPTSIRTFRNLQFFDFSGNSLLEGPIPV 404
            L F    L G +   +G +  L+ LSL  NS    +P  +V+ ++LE LN+  N  +G+ P +L +L  L  LDLSGN FSG +   +    NL  L+L+ N F+G++P S+     L   D S  + + G +PV
Sbjct:  385 LDFEGNSLKGQIPEFLGYMKALKVLSLGRNSFSGYVPSSMVNLQQLERLNLGENNLNGSFPVELMALTSLSELDLSGNRFSGAVPVSISNLSNLSFLNLSGNGFSGEIPASVGNLFKLTALDLSKQN-MSGEVPV 518          

HSP 4 Score: 74.7146 bits (182), Expect = 2.386e-13
Identity = 53/157 (33.76%), Postives = 81/157 (51.59%), Query Frame = 3
Query:   21 ELTGVLSPSIGRLSELRELSLANNSLVDLLPPQI-------------------------VDCKK-LEILNVQNNQFSGTIPSDLSSLIRLRVLDLSGNSFSG----NLGFLKYFPNLEHLSLAKNLFTGKVPTSIRTFRNLQFFDFSGNSLLEGPIP 401
            E+ GV+  + G L +L  LSL+NN+    +P  +                          +C+  L++L++Q N+ SG  P  L++++ L+ LD+SGN FSG    ++G LK    LE L LA N  TG++P  I+   +L   DF GNS L+G IP
Sbjct:  245 EIGGVIPAAYGALPKLEVLSLSNNNFSGTVPFSLFCNTSLTIVQLGFNAFSDIVRPETTANCRTGLQVLDLQENRISGRFPLWLTNILSLKNLDVSGNLFSGEIPPDIGNLK---RLEELKLANNSLTGEIPVEIKQCGSLDVLDFEGNS-LKGQIP 397          

HSP 5 Score: 71.633 bits (174), Expect = 2.019e-12
Identity = 43/129 (33.33%), Postives = 70/129 (54.26%), Query Frame = 3
Query:   27 TGVLSPSIGRLSELRELSLANNSLVDLLPPQIVDCKKLEILNVQNNQFSGTIPSDLSSLIRLRVLDLSGNSFSGNL----GFLKYFPNLEHLSLAKNLFTGKVPTSIRTFRNLQFFDFSGNSLLEGPIP 401
            +G +  S+G L +L  L L+  ++   +P ++     ++++ +Q N FSG +P   SSL+ LR ++LS NSFSG +    GFL+    L  LSL+ N  +G +P  I     L+  +   N L+ G IP
Sbjct:  489 SGEIPASVGNLFKLTALDLSKQNMSGEVPVELSGLPNVQVIALQGNNFSGVVPEGFSSLVSLRYVNLSSNSFSGEIPQTFGFLRL---LVSLSLSDNHISGSIPPEIGNCSALEVLELRSNRLM-GHIP 613          

HSP 6 Score: 71.2478 bits (173), Expect = 2.638e-12
Identity = 47/131 (35.88%), Postives = 68/131 (51.91%), Query Frame = 3
Query:   15 PRELTGVLSPSIGRLSELRELSLANNSLVDLLPPQIVDCKKLEILNVQNNQFSGTIPSDLSSLIRLRVLDLSGNSFSGNL-GFLKYFPNLEHLSLAKNLFTGKVPTSIRTFRNLQFFDFSGNSLLEGPIPV 404
            P  LT +LS        L+ L ++ N     +PP I + K+LE L + NN  +G IP ++     L VLD  GNS  G +  FL Y   L+ LSL +N F+G VP+S+   + L+  +   N+ L G  PV
Sbjct:  325 PLWLTNILS--------LKNLDVSGNLFSGEIPPDIGNLKRLEELKLANNSLTGEIPVEIKQCGSLDVLDFEGNSLKGQIPEFLGYMKALKVLSLGRNSFSGYVPSSMVNLQQLERLNLGENN-LNGSFPV 446          

HSP 7 Score: 69.707 bits (169), Expect = 7.674e-12
Identity = 45/125 (36.00%), Postives = 68/125 (54.40%), Query Frame = 3
Query:   30 GVLSPSIGRLSELRELSLANNSLVDLLPPQIVDCKKLEILNVQNNQFSGTIPSDLSSLIRLRVLDLSGNSFSGNL-GFLKYFPNLEHLSLAKNLFTGKVPTSIRTFRNLQFFDFSGNSLLEGPIP 401
            G +  S+   + L  + L  NSL   LPP + +   LE+ NV  N+ SG IP  L S   L+ LD+S N+FSG +   L     L+ L+L+ N  TG++P S+   ++LQ+     N LL+G +P
Sbjct:  106 GTIPTSLAYCTRLLSVFLQYNSLSGKLPPAMRNLTSLEVFNVAGNRLSGEIPVGLPS--SLQFLDISSNTFSGQIPSGLANLTQLQLLNLSYNQLTGEIPASLGNLQSLQYLWLDFN-LLQGTLP 227          
BLAST of CX287430 vs. ExPASy Swiss-Prot
Match: Y1341_ARATH (Probable LRR receptor-like serine/threonine-protein kinase At1g34110 OS=Arabidopsis thaliana GN=At1g34110 PE=2 SV=2)

HSP 1 Score: 83.9593 bits (206), Expect = 3.932e-16
Identity = 55/131 (41.98%), Postives = 72/131 (54.96%), Query Frame = 3
Query:   21 ELTGVLSPSIGRLSELRELSLANNSLVDLLPPQIVDCKKLEILNVQNNQFSGTIPSDLSSLIRLRVLDLSGNSFSGNL----GFLKYFPNLEHLSLAKNLFTGKVPTSIRTFRNLQFFDFSGNSLLEGPIP 401
            +L+G +   IG L  L  L L  N     LP +I +   LE+L+V NN  +G IP+ L +L+ L  LDLS NSF+GN+    G L Y   L  L L  NL TG++P SI+  + L   D S NS L G IP
Sbjct:  463 QLSGQIPKEIGELQNLVFLDLYMNHFSGGLPYEISNITVLELLDVHNNYITGDIPAQLGNLVNLEQLDLSRNSFTGNIPLSFGNLSY---LNKLILNNNLLTGQIPKSIKNLQKLTLLDLSYNS-LSGEIP 589          

HSP 2 Score: 80.8777 bits (198), Expect = 3.329e-15
Identity = 47/128 (36.72%), Postives = 71/128 (55.47%), Query Frame = 3
Query:   21 ELTGVLSPSIGRLSELRELSLANNSLVDLLPPQIVDCKKLEILNVQNNQFSGTIPSDLSSLIRLRVLDLSGNSFSGNLGF-LKYFPNLEHLSLAKNLFTGKVPTSIRTFRNLQFFDFSGNSLLEGPIP 401
            +LTG +   +G+L ++  L L  NSL  ++PP+I +C  L + +V  N  +G IP DL  L+ L  L LS N F+G + + L    +L  L L KN  +G +P+ I   ++LQ F    NS + G IP
Sbjct:  271 KLTGSIPKELGKLQKITSLLLWGNSLSGVIPPEISNCSSLVVFDVSANDLTGDIPGDLGKLVWLEQLQLSDNMFTGQIPWELSNCSSLIALQLDKNKLSGSIPSQIGNLKSLQSFFLWENS-ISGTIP 397          

HSP 3 Score: 72.4034 bits (176), Expect = 1.184e-12
Identity = 43/121 (35.54%), Postives = 66/121 (54.55%), Query Frame = 3
Query:   42 PSIGRLSELRELSLANNSLVDLLPPQIVDCKKLEILNVQNNQFSGTIPSDLSSLIRLRVLDLSGNSFSGNL-GFLKYFPNLEHLSLAKNLFTGKVPTSIRTFRNLQFFDFSGNSLLEGPIP 401
            P +  LS L+ L+L++ +L   +PP       L +L++ +N  SG IPS+L  L  L+ L L+ N  SG++   +     L+ L L  NL  G +P+S  +  +LQ F   GN+ L GPIP
Sbjct:   85 PDLSSLSSLQFLNLSSTNLSGPIPPSFGKLTHLRLLDLSSNSLSGPIPSELGRLSTLQFLILNANKLSGSIPSQISNLFALQVLCLQDNLLNGSIPSSFGSLVSLQQFRLGGNTNLGGPIP 205          

HSP 4 Score: 71.633 bits (174), Expect = 2.019e-12
Identity = 48/129 (37.21%), Postives = 63/129 (48.84%), Query Frame = 3
Query:   21 ELTGVLSPSIGRLSELRELSLANNSLVDLLPPQIVDCKKLEILNVQNNQFSGTIPSDLSSLIRLRVLDLSGNSFSGNLGF-LKYFPNLEHLSLAKNLFTGKVPTSIRTFRNLQFFDFSGNSLLEGPIPV 404
            +LTG +   +  L  L +L L  NSL   LP  +  C+ L  L V  NQ SG IP ++  L  L  LDL  N FSG L + +     LE L +  N  TG +P  +    NL+  D S NS   G IP+
Sbjct:  415 KLTGRIPEELFSLKRLSKLLLLGNSLSGGLPKSVAKCQSLVRLRVGENQLSGQIPKEIGELQNLVFLDLYMNHFSGGLPYEISNITVLELLDVHNNYITGDIPAQLGNLVNLEQLDLSRNS-FTGNIPL 542          

HSP 5 Score: 67.3958 bits (163), Expect = 3.809e-11
Identity = 46/130 (35.38%), Postives = 66/130 (50.77%), Query Frame = 3
Query:   24 LTGVLSPSIGRLSELRELSLANNSLVDLLPPQIVDCKKLEILNVQNNQFSGTIPSDLSSLIRLRVLDLSGNSFSGNLGF-LKYFPNLE-HLSLAKNLFTGKVPTSIRTFRNLQFFDFSGNSLLEGPIPVM 407
            +TG +   +G L  L +L L+ NS    +P    +   L  L + NN  +G IP  + +L +L +LDLS NS SG +   L    +L  +L L+ N FTG +P +      LQ  D S NS L G I V+
Sbjct:  512 ITGDIPAQLGNLVNLEQLDLSRNSFTGNIPLSFGNLSYLNKLILNNNLLTGQIPKSIKNLQKLTLLDLSYNSLSGEIPQELGQVTSLTINLDLSYNTFTGNIPETFSDLTQLQSLDLSSNS-LHGDIKVL 640          
BLAST of CX287430 vs. ExPASy Swiss-Prot
Match: IMK3_ARATH (Probable leucine-rich repeat receptor-like protein kinase IMK3 OS=Arabidopsis thaliana GN=IMK3 PE=1 SV=1)

HSP 1 Score: 83.5741 bits (205), Expect = 5.136e-16
Identity = 51/130 (39.23%), Postives = 79/130 (60.77%), Query Frame = 3
Query:   24 LTGVLSPSIGRLS-ELRELSLANNSLVDLLPPQIVDCKKLEILNVQNNQFSGTIPSDLSSLIRLRVLDLSGNSFSGNL-GFLKYFPNLEHLSLAKNLFTGKVPTSIRTFRNLQFFDFSGNSLLEGPIPVM 407
            L+G +  + G  S  LR LSL +NSL    P  + +  +L+  +  +N+  GT+PS+LS L +LR +D+SGNS SG++   L    +L HL L++N  TG++P SI    +L FF+ S N+ L GP+P +
Sbjct:  233 LSGPILDTWGSKSLNLRVLSLDHNSLSGPFPFSLCNLTQLQDFSFSHNRIRGTLPSELSKLTKLRKMDISGNSVSGHIPETLGNISSLIHLDLSQNKLTGEIPISISDLESLNFFNVSYNN-LSGPVPTL 361          

HSP 2 Score: 68.5514 bits (166), Expect = 1.710e-11
Identity = 48/128 (37.50%), Postives = 65/128 (50.78%), Query Frame = 3
Query:   24 LTGVLSPSIGRLSELRELSLANNSLVDLLPPQIVDCKKLEILNVQNNQFSGTIPSDLSSLIRLRVLDLSGNSFSGNL--GFLKYFPNLEHLSLAKNLFTGKVPTSIRTFRNLQFFDFSGNSLLEGPIP 401
            LTG +  S+G    L+ L L+NN L +++PP + D  KL  LN+  N  SG IP  LS    L+ L L  N+ SG +   +     NL  LSL  N  +G  P S+     LQ F FS N  + G +P
Sbjct:  161 LTGSIPASLGVSHFLQTLDLSNNLLSEIIPPNLADSSKLLRLNLSFNSLSGQIPVSLSRSSSLQFLALDHNNLSGPILDTWGSKSLNLRVLSLDHNSLSGPFPFSLCNLTQLQDFSFSHNR-IRGTLP 287          
BLAST of CX287430 vs. ExPASy Swiss-Prot
Match: EFR_ARATH (LRR receptor-like serine/threonine-protein kinase EFR OS=Arabidopsis thaliana GN=EFR PE=1 SV=1)

HSP 1 Score: 83.5741 bits (205), Expect = 5.136e-16
Identity = 54/128 (42.19%), Postives = 71/128 (55.47%), Query Frame = 3
Query:   21 ELTGVLSPSIGRLSELRELSLANNSLVDLLPPQIVDCKKLEILNVQNNQFSGTIPSDLSSLIRLRVLDLSGNSFS-GNLGFLKYFPNLEHLSLAKNLFTGKVPTSIRTFRNLQFFDFSGNSLLEGPIP 401
            +LTGV+SPSIG LS LR L+LA+NS    +P ++    +L+ LN+  N   G IPS LS+  RL  +DLS N    G    L     L  L L+KN  TG  P S+    +LQ  DF+ N  + G IP
Sbjct:   84 KLTGVISPSIGNLSFLRLLNLADNSFGSTIPQKVGRLFRLQYLNMSYNLLEGRIPSSLSNCSRLSTVDLSSNHLGHGVPSELGSLSKLAILDLSKNNLTGNFPASLGNLTSLQKLDFAYNQ-MRGEIP 210          

HSP 2 Score: 78.5666 bits (192), Expect = 1.652e-14
Identity = 47/129 (36.43%), Postives = 67/129 (51.94%), Query Frame = 3
Query:   24 LTGVLSPSIGRLSELRELSLANNSLVDLLPPQIVDCKKLEILNVQNNQFSGTIPSDLSSLIRLRVLDLSGNSFSGNL--GFLKYFPNLEHLSLAKNLFTGKVPTSIRTFRNLQFFDFSGNSLLEGPIPV 404
            LTG    S+G L+ L++L  A N +   +P ++    ++    +  N FSG  P  L ++  L  L L+ NSFSGNL   F    PNL  L L  N FTG +P ++    +L+ FD S N  L G IP+
Sbjct:  181 LTGNFPASLGNLTSLQKLDFAYNQMRGEIPDEVARLTQMVFFQIALNSFSGGFPPALYNISSLESLSLADNSFSGNLRADFGYLLPNLRRLLLGTNQFTGAIPKTLANISSLERFDISSN-YLSGSIPL 308          

HSP 3 Score: 74.3294 bits (181), Expect = 3.116e-13
Identity = 47/130 (36.15%), Postives = 70/130 (53.85%), Query Frame = 3
Query:   24 LTGVLSPSIGRLSELRELSLANNSLVDLLPPQIVDCKKLEILNVQNNQFSGTIPSDLSSLIRLRVLDLSGNSFSGNLG-FLKYFPNLEHLSLAKNLFTGKVPTSIRTFRNLQFFDFSGNSLLEGPIPVMR 410
            LTG     +G+L  L  L  + N L   +P  I  C  +E L +Q N F G IP D+S L+ L+ +D S N+ SG +  +L   P+L +L+L+ N F G+VPT+   FRN       GN+ + G +  M+
Sbjct:  501 LTGHFPEEVGKLELLVGLGASYNKLSGKMPQAIGGCLSMEFLFMQGNSFDGAIP-DISRLVSLKNVDFSNNNLSGRIPRYLASLPSLRNLNLSMNKFEGRVPTT-GVFRNATAVSVFGNTNICGGVREMQ 628          
BLAST of CX287430 vs. ExPASy Swiss-Prot
Match: FLS2_ARATH (LRR receptor-like serine/threonine-protein kinase FLS2 OS=Arabidopsis thaliana GN=FLS2 PE=1 SV=1)

HSP 1 Score: 83.1889 bits (204), Expect = 6.707e-16
Identity = 56/151 (37.09%), Postives = 77/151 (50.99%), Query Frame = 3
Query:   24 LTGVLSPSIGRLSELRELSLANNSLVDLLPPQIVDCKKLEILNVQNNQFSGTIPSDLSSLIRLR------------------------VLDLSGNSFSGNL-GFLKYFPNLEHLSLAKNLFTGKVPTSIRTFRNLQFFDFSGNSLLEGPIP 401
            LTG L P IG+L +LR L ++ NSL   +P +I + K L IL + +N F+G IP ++S+L  L+                        VLDLS N FSG +        +L +LSL  N F G +P S+++   L  FD S N LL G IP
Sbjct:  467 LTGTLKPLIGKLQKLRILQVSYNSLTGPIPREIGNLKDLNILYLHSNGFTGRIPREMSNLTLLQGLRMYSNDLEGPIPEEMFDMKLLSVLDLSNNKFSGQIPALFSKLESLTYLSLQGNKFNGSIPASLKSLSLLNTFDISDN-LLTGTIP 616          

HSP 2 Score: 73.9442 bits (180), Expect = 4.069e-13
Identity = 46/128 (35.94%), Postives = 69/128 (53.91%), Query Frame = 3
Query:   21 ELTGVLSPSIGRLSELRELSLANNSLVDLLPPQIVDCKKLEILNVQNNQFSGTIPSDLSSLIRLRVLDLSGNSFSGNL-GFLKYFPNLEHLSLAKNLFTGKVPTSIRTFRNLQFFDFSGNSLLEGPIP 401
            +LT  +  S+ RL++L  L L+ N LV  +  +I   + LE+L + +N F+G  P  +++L  L VL +  N+ SG L   L    NL +LS   NL TG +P+SI     L+  D S N  + G IP
Sbjct:  299 KLTSSIPSSLFRLTQLTHLGLSENHLVGPISEEIGFLESLEVLTLHSNNFTGEFPQSITNLRNLTVLTVGFNNISGELPADLGLLTNLRNLSAHDNLLTGPIPSSISNCTGLKLLDLSHNQ-MTGEIP 425          

HSP 3 Score: 68.9366 bits (167), Expect = 1.309e-11
Identity = 54/153 (35.29%), Postives = 73/153 (47.71%), Query Frame = 3
Query:   18 RELTGVLSPSIGRLSELRELSLANNSLVDLLPPQIVDCKKLEILNVQNNQFSGTIPSDLSSLIRLRVLDLSGNSFSGN-------------LGF---------LKYFPNLEHLSL---AKNLFTGKVPTSIRTFRNLQFFDFSGNSLLEGPIP 401
            ++L GVLSP+I  L+ L+ L L +NS    +P +I    +L  L +  N FSG+IPS +  L  +  LDL  N  SG+             +GF          +   +L HL +   A N  TG +P SI T  NL   D SGN  L G IP
Sbjct:   82 KQLEGVLSPAIANLTYLQVLDLTSNSFTGKIPAEIGKLTELNQLILYLNYFSGSIPSGIWELKNIFYLDLRNNLLSGDVPEEICKTSSLVLIGFDYNNLTGKIPECLGDLVHLQMFVAAGNHLTGSIPVSIGTLANLTDLDLSGNQ-LTGKIP 233          

HSP 4 Score: 66.6254 bits (161), Expect = 6.496e-11
Identity = 45/131 (34.35%), Postives = 68/131 (51.91%), Query Frame = 3
Query:   21 ELTGVLSPSIGRLSELRELSLANNSLVDLLPPQIVDCKKLEILNVQNNQFSGTIPSDLSSLIRLRVLDLSGNSFSG----NLGFLKYFPNLEHLSLAKNLFTGKVPTSIRTFRNLQFFDFSGNSLLEGPIP 401
            ++TG +    GR++ L  +S+  N     +P  I +C  LE L+V +N  +GT+   +  L +LR+L +S NS +G     +G LK   +L  L L  N FTG++P  +     LQ      N  LEGPIP
Sbjct:  419 QMTGEIPRGFGRMN-LTFISIGRNHFTGEIPDDIFNCSNLETLSVADNNLTGTLKPLIGKLQKLRILQVSYNSLTGPIPREIGNLK---DLNILYLHSNGFTGRIPREMSNLTLLQGLRMYSND-LEGPIP 544          

HSP 5 Score: 66.2402 bits (160), Expect = 8.485e-11
Identity = 41/130 (31.54%), Postives = 69/130 (53.08%), Query Frame = 3
Query:   24 LTGVLSPSIGRLSELRELSLANNSLVDLLPPQIVDCKKLEILNVQNNQFSGTIPSDL-SSLIRLRVLDLSGNSFSGNLGFLKYFPNLEH---LSLAKNLFTGKVPTSIRTFRNLQFFDFSGNSLLEGPIP 401
            LTG +   +G+L  ++E+ L+NN     +P  +  CK +  L+   N  SG IP ++   +  +  L+LS NSFSG +   + F N+ H   L L+ N  TG++P S+     L+    + N+ L+G +P
Sbjct:  637 LTGTIPKELGKLEMVQEIDLSNNLFSGSIPRSLQACKNVFTLDFSQNNLSGHIPDEVFQGMDMIISLNLSRNSFSGEIP--QSFGNMTHLVSLDLSSNNLTGEIPESLANLSTLKHLKLASNN-LKGHVP 763          
The following BLAST results are available for this feature:
BLAST of CX287430 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 66
Match NameE-valueIdentityDescription
HSL1_ARATH1.444e-1842.22Receptor-like protein kinase HSL1 OS=Arabidopsis t... [more]
RCH1_ARATH2.463e-1838.81LRR receptor-like serine/threonine-protein kinase ... [more]
RCH2_ARATH2.723e-1737.80Receptor-like protein kinase 2 OS=Arabidopsis thal... [more]
ERL2_ARATH4.645e-1739.06LRR receptor-like serine/threonine-protein kinase ... [more]
PSKR2_ARATH1.765e-1634.62Phytosulfokine receptor 2 OS=Arabidopsis thaliana ... [more]
Y4361_ARATH3.932e-1637.33Probable LRR receptor-like serine/threonine-protei... [more]
Y1341_ARATH3.932e-1641.98Probable LRR receptor-like serine/threonine-protei... [more]
IMK3_ARATH5.136e-1639.23Probable leucine-rich repeat receptor-like protein... [more]
EFR_ARATH5.136e-1642.19LRR receptor-like serine/threonine-protein kinase ... [more]
FLS2_ARATH6.707e-1637.09LRR receptor-like serine/threonine-protein kinase ... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC01009E01SK Veg1 Citrus clementina cDNA clone C01009E01, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CX287430 ID=CX287430; Name=CX287430; organism=Citrus clementina; type=EST; length=486bp
AGCTCGTGTTTGTGCCTAGAGAGCTTACTGGGGTTCTTTCCCCGTCAATC
GGACGGCTGTCAGAGCTCAGAGAGCTCTCTCTGGCTAACAACAGCCTCGT
TGACCTGCTGCCACCCCAAATCGTTGACTGCAAGAAACTTGAAATTCTTA
ACGTTCAAAATAATCAGTTTTCTGGCACAATCCCCTCCGATTTGTCTTCT
TTAATTCGTCTTCGTGTTCTCGATCTTTCTGGGAATAGTTTTTCGGGGAA
TTTGGGTTTCCTGAAATATTTTCCAAACTTGGAACATCTCTCTTTAGCTA
AAAATCTGTTCACCGGAAAAGTCCCAACTTCCATACGTACATTTCGCAAT
CTCCAATTCTTCGACTTCTCCGGAAACAGTCTCCTTGAAGGTCCAATACC
AGTGATGAGAAGGGTTGGACCCTCAGGGTTTCAATACCCAAAACGATACG
TTTTGGCTGAGACTACCACCAATGGAAGAAGCAATG
back to top