CX287477
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of CX287477 vs. ExPASy Swiss-Prot
Match: MT3_CARPA (Metallothionein-like protein type 3 OS=Carica papaya PE=3 SV=1) HSP 1 Score: 80.8777 bits (198), Expect = 2.289e-15 Identity = 34/54 (62.96%), Postives = 43/54 (79.63%), Query Frame = -2 Query: 263 RSQCVKKGSSYAADFVETDLSFVSTVVVMDVQAAETEGNCKCGPTCACVNCTCG 424 ++QCVKKGSSY AD +ET+ S ++ VVMD AAE +G CKCGP+C+C NCTCG Sbjct: 13 KTQCVKKGSSYTADIIETEKSIMT--VVMDAPAAENDGKCKCGPSCSCTNCTCG 64
BLAST of CX287477 vs. ExPASy Swiss-Prot
Match: MT3_MUSAC (Metallothionein-like protein type 3 OS=Musa acuminata PE=3 SV=1) HSP 1 Score: 72.0182 bits (175), Expect = 1.063e-12 Identity = 31/55 (56.36%), Postives = 40/55 (72.73%), Query Frame = -2 Query: 260 RSQCVKKGSSYAADFVETDLSFVSTVVVMDVQAAETEGNCKCGPTCACVNCTCGS 424 +SQCVKKG+SY D VET+ S+V V+V +AAE +G CKCG CAC +C CG+ Sbjct: 12 KSQCVKKGNSYGIDIVETEKSYVDEVIVA-AEAAEHDGKCKCGAACACTDCKCGN 65
BLAST of CX287477 vs. ExPASy Swiss-Prot
Match: MT3_ACTDE (Metallothionein-like protein type 3 OS=Actinidia deliciosa GN=pKIWI503 PE=2 SV=1) HSP 1 Score: 67.0106 bits (162), Expect = 3.420e-11 Identity = 33/52 (63.46%), Postives = 38/52 (73.08%), Query Frame = -2 Query: 266 SQCVKKGSSYAADFVETDLSFVSTVVVMDVQAAETEGNCKCGPTCACVNCTC 421 SQCVKKG+S D VETD S++ VV M V AAE+ G CKCG +C CVNCTC Sbjct: 14 SQCVKKGNSI--DIVETDKSYIEDVV-MGVPAAESGGKCKCGTSCPCVNCTC 62
BLAST of CX287477 vs. ExPASy Swiss-Prot
Match: MT3_PRUAV (Metallothionein-like protein 1 OS=Prunus avium GN=MT1 PE=3 SV=1) HSP 1 Score: 65.4698 bits (158), Expect = 9.951e-11 Identity = 30/52 (57.69%), Postives = 36/52 (69.23%), Query Frame = -2 Query: 266 SQCVKKGSSYAADFVETDLSFVSTVVVMDVQAAETEGNCKCGPTCACVNCTC 421 SQC KKG S+ VET+ + TV+ MD AAE GNCKCGP+CACV+C C Sbjct: 14 SQCTKKGYSFDLVIVETENRSMDTVI-MDAPAAENGGNCKCGPSCACVDCKC 64 The following BLAST results are available for this feature:
BLAST of CX287477 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 4
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >CX287477 ID=CX287477; Name=CX287477; organism=Citrus clementina; type=EST; length=425bpback to top |