CX287753
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Alignments
Homology
BLAST of CX287753 vs. ExPASy Swiss-Prot
Match: RRFC_SPIOL (Ribosome-recycling factor, chloroplastic OS=Spinacia oleracea GN=RRF PE=1 SV=1) HSP 1 Score: 80.8777 bits (198), Expect = 2.258e-15 Identity = 38/43 (88.37%), Postives = 43/43 (100.00%), Query Frame = -2 Query: 258 ALKAYEKLQKEKKLSEDNVKDLSSDLQKLTDEYMKKIDSIYKQ 386 ALK+YEKL+KEKKLSEDNVKDLS+DLQKLTDEYMKK++SIYKQ Sbjct: 221 ALKSYEKLEKEKKLSEDNVKDLSADLQKLTDEYMKKVESIYKQ 263
BLAST of CX287753 vs. ExPASy Swiss-Prot
Match: RRFC_ORYSJ (Ribosome-recycling factor, chloroplastic OS=Oryza sativa subsp. japonica GN=Os07g0570700 PE=2 SV=2) HSP 1 Score: 75.0998 bits (183), Expect = 1.239e-13 Identity = 35/43 (81.40%), Postives = 42/43 (97.67%), Query Frame = -2 Query: 258 ALKAYEKLQKEKKLSEDNVKDLSSDLQKLTDEYMKKIDSIYKQ 386 A+KAY+KL+KEKKLSEDNVKDLS+DLQK+TDEYMKKI++I KQ Sbjct: 216 AIKAYDKLEKEKKLSEDNVKDLSADLQKVTDEYMKKIEAIQKQ 258
BLAST of CX287753 vs. ExPASy Swiss-Prot
Match: RRFC_ORYSI (Ribosome-recycling factor, chloroplastic OS=Oryza sativa subsp. indica GN=OsI_26546 PE=1 SV=2) HSP 1 Score: 75.0998 bits (183), Expect = 1.239e-13 Identity = 35/43 (81.40%), Postives = 42/43 (97.67%), Query Frame = -2 Query: 258 ALKAYEKLQKEKKLSEDNVKDLSSDLQKLTDEYMKKIDSIYKQ 386 A+KAY+KL+KEKKLSEDNVKDLS+DLQK+TDEYMKKI++I KQ Sbjct: 216 AIKAYDKLEKEKKLSEDNVKDLSADLQKVTDEYMKKIEAIQKQ 258
BLAST of CX287753 vs. ExPASy Swiss-Prot
Match: RRFC_DAUCA (Ribosome-recycling factor, chloroplastic (Fragment) OS=Daucus carota GN=RRF PE=2 SV=2) HSP 1 Score: 75.0998 bits (183), Expect = 1.239e-13 Identity = 34/43 (79.07%), Postives = 42/43 (97.67%), Query Frame = -2 Query: 258 ALKAYEKLQKEKKLSEDNVKDLSSDLQKLTDEYMKKIDSIYKQ 386 A+K+Y+KL+KEKKLSEDNVKDLSSDLQK+ DEY+KK+DSI+KQ Sbjct: 177 AIKSYDKLEKEKKLSEDNVKDLSSDLQKVIDEYIKKVDSIFKQ 219
BLAST of CX287753 vs. ExPASy Swiss-Prot
Match: RRFC_ARATH (Ribosome-recycling factor, chloroplastic OS=Arabidopsis thaliana GN=RRF PE=1 SV=2) HSP 1 Score: 73.9442 bits (180), Expect = 2.760e-13 Identity = 35/43 (81.40%), Postives = 40/43 (93.02%), Query Frame = -2 Query: 258 ALKAYEKLQKEKKLSEDNVKDLSSDLQKLTDEYMKKIDSIYKQ 386 ALK+Y+KL+KEKKLSEDNVKDLSSDLQKL D YMKKI+ +YKQ Sbjct: 225 ALKSYDKLEKEKKLSEDNVKDLSSDLQKLIDVYMKKIEELYKQ 267 The following BLAST results are available for this feature:
BLAST of CX287753 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 5
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >CX287753 ID=CX287753; Name=CX287753; organism=Citrus clementina; type=EST; length=387bpback to top |