CX288530

Overview
NameCX288530
Unique NameCX288530
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length567
Libraries
Library NameType
IF1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig11825 contig Ccv1_Contig11825:347..913. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CX288530 vs. ExPASy Swiss-Prot
Match: WAX2_ARATH (Protein WAX2 OS=Arabidopsis thaliana GN=WAX2 PE=1 SV=1)

HSP 1 Score: 214.927 bits (546), Expect = 2.183e-55
Identity = 104/194 (53.61%), Postives = 129/194 (66.49%), Query Frame = 1
Query:    1 LVGKALYSWVYEDKRIEY-WCLHILIISVLRGLIHILWNSFSNMLFLNRARQINQRGVDFKQIDNEWNWDNFILLQAAIASMGYYIFP----CSESLPRWNTKGFIALQILHVAVSEPLYYVLHRHFHRNKYLFTHYHSLHHSSPVPQIPTAGHATLLEHIVLSVIVAIPXXXXXXXXXXXXXXXXXXXXMFDF 567
            L  + +YSWVYE+   +  WC+HILII  L+ L+H LW+ F+NMLF+ R  +IN +G+DFKQID+EW+WDN+I+LQA I S+  Y+ P       SLP WNTKG IAL +LHV  SEPLYY LHR FHRN Y FTHYHS HHSSPVP   TAG+ATLLE+I+L V+  +P                    MFDF
Sbjct:   24 LAAQVVYSWVYEEDISKVLWCIHILIICGLKALVHELWSVFNNMLFVTRTLRINPKGIDFKQIDHEWHWDNYIILQAIIVSLICYMSPPLMMMINSLPLWNTKGLIALIVLHVTFSEPLYYFLHRSFHRNNYFFTHYHSFHHSSPVPHPMTAGNATLLENIILCVVAGVPLIGCCLFGVGSLSAIYGYAVMFDF 217          
The following BLAST results are available for this feature:
BLAST of CX288530 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 1
Match NameE-valueIdentityDescription
WAX2_ARATH2.183e-5553.61Protein WAX2 OS=Arabidopsis thaliana GN=WAX2 PE=1 ... [more]
back to top
Properties
Property NameValue
Genbank descriptionC02001E01SK IF1 Citrus clementina cDNA clone C02001E01, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CX288530 ID=CX288530|Name=CX288530|organism=Citrus clementina|type=EST|length=567bp
CTCGTCGGAAAAGCTTTATACTCATGGGTTTATGAAGATAAACGAATTGA
ATATTGGTGCCTCCATATTCTGATCATCTCCGTGCTTAGAGGACTGATTC
ATATCTTATGGAACTCTTTCAGTAACATGCTTTTCCTTAATCGTGCTCGC
CAGATTAATCAACGGGGAGTCGATTTCAAGCAGATTGATAATGAATGGAA
CTGGGATAATTTCATTCTACTTCAAGCTGCAATTGCATCCATGGGCTATT
ACATCTTTCCATGCTCTGAAAGCCTTCCTCGATGGAACACAAAAGGATTT
ATTGCACTACAGATACTTCATGTGGCTGTTTCAGAGCCTTTATATTACGT
TTTACACCGACATTTTCACAGAAATAAATACCTTTTCACCCATTACCACT
CACTCCACCATTCATCTCCAGTACCACAAATTCCAACAGCTGGGCATGCA
ACATTATTGGAGCACATTGTATTAAGTGTCATCGTTGCAATTCCAATTCT
CGGATCTTCTATCATCGGATATGGATCAATAAGCTTGATTTATGGCTATA
TTTTGATGTTTGATTTT
back to top