CX289357
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of CX289357 vs. ExPASy Swiss-Prot
Match: PUB34_ARATH (U-box domain-containing protein 34 OS=Arabidopsis thaliana GN=PUB34 PE=2 SV=1) HSP 1 Score: 80.4925 bits (197), Expect = 2.972e-15 Identity = 35/52 (67.31%), Postives = 43/52 (82.69%), Query Frame = -3 Query: 159 IAADGFTYEHRAIKAWLEKHNVSPVTKLRLQHLSIIPNYTLRSAIQQWRSPV 314 IAADGFTYE +AI AWLEKHN+SPVT+ +L H + PN+TLRSAI+ W+S V Sbjct: 743 IAADGFTYERKAILAWLEKHNISPVTRQKLDHFKLTPNHTLRSAIRDWKSRV 794
BLAST of CX289357 vs. ExPASy Swiss-Prot
Match: PUB53_ARATH (Putative U-box domain-containing protein 53 OS=Arabidopsis thaliana GN=PUB53 PE=3 SV=1) HSP 1 Score: 67.781 bits (164), Expect = 1.993e-11 Identity = 32/69 (46.38%), Postives = 46/69 (66.67%), Query Frame = -3 Query: 165 CRCLCKVGKQQCLCTKPLLIAADGFTYEHRAIKAWLEKHNVSPVTKLRLQHLSIIPNYTLRSAIQQWRS 371 C L V K+ C IAADG+TY+ RAI+ W+E H SPVT LQ+++++PN+TL +AI +WR+ Sbjct: 755 CPLLKDVMKEPC-------IAADGYTYDRRAIEEWMENHRTSPVTNSPLQNVNLLPNHTLYAAIVEWRN 816
BLAST of CX289357 vs. ExPASy Swiss-Prot
Match: PUB33_ARATH (U-box domain-containing protein 33 OS=Arabidopsis thaliana GN=PUB33 PE=2 SV=2) HSP 1 Score: 66.2402 bits (160), Expect = 5.800e-11 Identity = 29/49 (59.18%), Postives = 40/49 (81.63%), Query Frame = -3 Query: 171 IAADGFTYEHRAIKAWLE-KHNVSPVTKLRLQHLSIIPNYTLRSAIQQW 314 +AADGFTYE AI+AWL+ +H+ SP+T ++L H S+I N+ LRSAIQ+W Sbjct: 781 VAADGFTYEAEAIRAWLDSEHDTSPMTNVKLSHTSLIANHALRSAIQEW 829 The following BLAST results are available for this feature:
BLAST of CX289357 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 3
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >CX289357 ID=CX289357; Name=CX289357; organism=Citrus clementina; type=EST; length=382bpback to top |