CX293877

Overview
NameCX293877
Unique NameCX293877
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length509
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig872 contig Ccv1_Contig872:40..548. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CX293877 vs. ExPASy Swiss-Prot
Match: HSP17_ARATH (17.4 kDa class I heat shock protein OS=Arabidopsis thaliana GN=HSP17.4A PE=1 SV=2)

HSP 1 Score: 207.994 bits (528), Expect = 2.036e-53
Identity = 100/157 (63.69%), Postives = 122/157 (77.71%), Query Frame = 2
Query:   38 MSLIPSIFGGRRTNVFDPVSLDVWDPFDGFLSSALTNAPSSARETSQFANARIDWKETAQAHVFKADLPGLRXXXXXXXXXXGRILQISGERSKEHEEKNDKWHRVQRSSGKFLRRFRLPDNAKVEQVKASMENGVLTVTXXXXXXXXXXXXAIEIS 508
            MSL+PS FGGRRTNVFDP SLDVWDPF+GFL+  LTNAP  A++ + F NA++DW+ET +AHVFKAD+PGL+          G ILQISGERS E+EEK+D WHRV+RSSGKF+RRFRLP+NAKVE+VKASMENGVL+VT            +++IS
Sbjct:    1 MSLVPSFFGGRRTNVFDPFSLDVWDPFEGFLTPGLTNAP--AKDVAAFTNAKVDWRETPEAHVFKADVPGLKKEEVKVEVEDGNILQISGERSSENEEKSDTWHRVERSSGKFMRRFRLPENAKVEEVKASMENGVLSVTVPKVQESKPEVKSVDIS 155          
BLAST of CX293877 vs. ExPASy Swiss-Prot
Match: HS181_ARATH (18.1 kDa class I heat shock protein OS=Arabidopsis thaliana GN=HSP18.1 PE=2 SV=1)

HSP 1 Score: 204.527 bits (519), Expect = 2.251e-52
Identity = 103/159 (64.78%), Postives = 123/159 (77.36%), Query Frame = 2
Query:   38 MSLIPSIFGGRRTNVFDPVSLDVWDPFDGFL--SSALTNAPSSARETSQFANARIDWKETAQAHVFKADLPGLRXXXXXXXXXXGRILQISGERSKEHEEKNDKWHRVQRSSGKFLRRFRLPDNAKVEQVKASMENGVLTVTXXXXXXXXXXXXAIEIS 508
            MSLIPSIFGGRR+NVFDP S D+WDPF+GF   SSAL NA S+AR+ + F NAR+DWKET +AHVFKADLPGL+            +LQISGERSKE+EEKNDKWHRV+R+SGKF+RRFRLP+NAK+E+VKA+MENGVLTV             +I+IS
Sbjct:    1 MSLIPSIFGGRRSNVFDPFSQDLWDPFEGFFTPSSALANA-STARDVAAFTNARVDWKETPEAHVFKADLPGLKKEEVKVEVEDKNVLQISGERSKENEEKNDKWHRVERASGKFMRRFRLPENAKMEEVKATMENGVLTVVVPKAPEKKPQVKSIDIS 158          
BLAST of CX293877 vs. ExPASy Swiss-Prot
Match: HS17C_ARATH (17.6 kDa class I heat shock protein 3 OS=Arabidopsis thaliana GN=HSP17.6C PE=2 SV=2)

HSP 1 Score: 204.527 bits (519), Expect = 2.251e-52
Identity = 104/158 (65.82%), Postives = 122/158 (77.22%), Query Frame = 2
Query:   38 MSLIPSIFGGRRTNVFDPVSLDVWDPFDGFLS-SALTNAPSSARETSQFANARIDWKETAQAHVFKADLPGLRXXXXXXXXXXGRILQISGERSKEHEEKNDKWHRVQRSSGKFLRRFRLPDNAKVEQVKASMENGVLTVTXXXXXXXXXXXXAIEIS 508
            MSLIPSIFGGRRTNVFDP SLDV+DPF+GFL+ S L NAP  A + + F NA++DW+ET +AHVFKADLPGLR          G ILQISGERS E+EEKNDKWHRV+RSSGKF RRFRLP+NAK+E++KASMENGVL+VT            +I+IS
Sbjct:    1 MSLIPSIFGGRRTNVFDPFSLDVFDPFEGFLTPSGLANAP--AMDVAAFTNAKVDWRETPEAHVFKADLPGLRKEEVKVEVEDGNILQISGERSNENEEKNDKWHRVERSSGKFTRRFRLPENAKMEEIKASMENGVLSVTVPKVPEKKPEVKSIDIS 156          
BLAST of CX293877 vs. ExPASy Swiss-Prot
Match: HSP11_DAUCA (17.8 kDa class I heat shock protein OS=Daucus carota PE=3 SV=1)

HSP 1 Score: 196.438 bits (498), Expect = 6.129e-50
Identity = 98/157 (62.42%), Postives = 115/157 (73.25%), Query Frame = 2
Query:   38 MSLIPSIFGGRRTNVFDPVSLDVWDPFDGFLSSALTNAPSSARETSQFANARIDWKETAQAHVFKADLPGLRXXXXXXXXXXGRILQISGERSKEHEEKNDKWHRVQRSSGKFLRRFRLPDNAKVEQVKASMENGVLTVTXXXXXXXXXXXXAIEIS 508
            MS+IPS FGGRR+NVFDP SLDVWDPF  F     ++A    +ET+ F N  IDWKET QAHVFKADLPGL+          G++LQISGER+KE EEKNDKWHRV+RSSGKFLRRFRLP+NAKV++VKA+M NGV+TVT            AI+IS
Sbjct:    1 MSIIPSFFGGRRSNVFDPFSLDVWDPFKDF-PLVTSSASEFGKETAAFVNTHIDWKETPQAHVFKADLPGLKKEEVKVELEEGKVLQISGERNKEKEEKNDKWHRVERSSGKFLRRFRLPENAKVDEVKAAMANGVVTVTVPKVEIKKPEVKAIDIS 156          
BLAST of CX293877 vs. ExPASy Swiss-Prot
Match: HSP16_SOYBN (18.5 kDa class I heat shock protein OS=Glycine max GN=HSP18.5-C PE=3 SV=1)

HSP 1 Score: 194.126 bits (492), Expect = 3.042e-49
Identity = 101/162 (62.35%), Postives = 116/162 (71.60%), Query Frame = 2
Query:   38 MSLIPSIFGGRRTNVFDPVSLDVWDPFDGF-----LSSALTNAPSSARETSQFANARIDWKETAQAHVFKADLPGLRXXXXXXXXXXGRILQISGERSKEHEEKNDKWHRVQRSSGKFLRRFRLPDNAKVEQVKASMENGVLTVTXXXXXXXXXXXXAIEIS 508
            MSLIP+ FGGRR NVFDP SLDVWDPF  F     LSSA  + P  +RE S F + R+DWKET +AHVFKAD+PGL+           ++LQISGER+ E E+KND WHRV+RSSGKF+RRFRLP+NAKVEQVKASMENGVLTVT            AIEIS
Sbjct:    1 MSLIPNFFGGRRNNVFDPFSLDVWDPFKDFPFPNTLSSA--SFPEFSRENSAFVSTRVDWKETPEAHVFKADIPGLKKEEVKVQIEDDKVLQISGERNVEKEDKNDTWHRVERSSGKFMRRFRLPENAKVEQVKASMENGVLTVTVPKEEVKKPDVKAIEIS 160          
BLAST of CX293877 vs. ExPASy Swiss-Prot
Match: HSP13_SOYBN (17.5 kDa class I heat shock protein OS=Glycine max GN=HSP17.5-M PE=3 SV=1)

HSP 1 Score: 191.045 bits (484), Expect = 2.575e-48
Identity = 99/158 (62.66%), Postives = 114/158 (72.15%), Query Frame = 2
Query:   38 MSLIPSIFGGRRTNVFDPVSLDVWDPFDGFLSSALTNAPSS-ARETSQFANARIDWKETAQAHVFKADLPGLRXXXXXXXXXXGRILQISGERSKEHEEKNDKWHRVQRSSGKFLRRFRLPDNAKVEQVKASMENGVLTVTXXXXXXXXXXXXAIEIS 508
            MSLIPSIFGGRR+NVFDP SLDVWDPF  F      + P+S + E S F N R+DWKET +AHVF+AD+PGL+           R+LQISGER+ E E+KND WHRV+RSSG F+RRFRLP+NAKVEQVKASMENGVLTVT            AIEIS
Sbjct:    1 MSLIPSIFGGRRSNVFDPFSLDVWDPFKDF------HFPTSLSAENSAFVNTRVDWKETPEAHVFEADIPGLKKEEVKVQIEDDRVLQISGERNLEKEDKNDTWHRVERSSGNFMRRFRLPENAKVEQVKASMENGVLTVTVPKEEVKKPDVKAIEIS 152          
BLAST of CX293877 vs. ExPASy Swiss-Prot
Match: HSP12_MEDSA (18.2 kDa class I heat shock protein OS=Medicago sativa GN=HSP18.2 PE=2 SV=1)

HSP 1 Score: 190.66 bits (483), Expect = 3.363e-48
Identity = 94/157 (59.87%), Postives = 113/157 (71.97%), Query Frame = 2
Query:   38 MSLIPSIFGGRRTNVFDPVSLDVWDPFDGFLSSALTNAPSSARETSQFANARIDWKETAQAHVFKADLPGLRXXXXXXXXXXGRILQISGERSKEHEEKNDKWHRVQRSSGKFLRRFRLPDNAKVEQVKASMENGVLTVTXXXXXXXXXXXXAIEIS 508
            MSLIPS FGGRR+NVFDP SLDVWDPF  F  +    + S  RE S F + R+DWKET +AHVFKADLPG++           R+LQISGERS E E+KND+WHR++RSSGKF+RRFRLP+NAK++QVKA+MENGVLTVT             I+IS
Sbjct:    1 MSLIPSFFGGRRSNVFDPFSLDVWDPFKDFPFNNSALSASFPRENSAFVSTRVDWKETPEAHVFKADLPGMKKEEVKVEIEDDRVLQISGERSVEKEDKNDQWHRLERSSGKFMRRFRLPENAKMDQVKAAMENGVLTVTVPKEEVKKPEVKTIDIS 157          
BLAST of CX293877 vs. ExPASy Swiss-Prot
Match: HSP11_PEA (18.1 kDa class I heat shock protein OS=Pisum sativum GN=HSP18.1 PE=2 SV=1)

HSP 1 Score: 189.889 bits (481), Expect = 5.736e-48
Identity = 96/157 (61.15%), Postives = 112/157 (71.34%), Query Frame = 2
Query:   38 MSLIPSIFGGRRTNVFDPVSLDVWDPFDGFLSSALTNAPSSARETSQFANARIDWKETAQAHVFKADLPGLRXXXXXXXXXXGRILQISGERSKEHEEKNDKWHRVQRSSGKFLRRFRLPDNAKVEQVKASMENGVLTVTXXXXXXXXXXXXAIEIS 508
            MSLIPS F GRR+NVFDP SLDVWDP   F  S  + + S  RE   F + R+DWKET +AHVFKADLPGL+           R+LQISGERS E E+KND+WHRV+RSSGKFLRRFRLP+NAK+++VKASMENGVLTVT            +IEIS
Sbjct:    1 MSLIPSFFSGRRSNVFDPFSLDVWDPLKDFPFSNSSPSASFPRENPAFVSTRVDWKETPEAHVFKADLPGLKKEEVKVEVEDDRVLQISGERSVEKEDKNDEWHRVERSSGKFLRRFRLPENAKMDKVKASMENGVLTVTVPKEEIKKAEVKSIEIS 157          
BLAST of CX293877 vs. ExPASy Swiss-Prot
Match: HSP11_SOYBN (17.3 kDa class I heat shock protein OS=Glycine max GN=HSP17.3-B PE=3 SV=1)

HSP 1 Score: 186.808 bits (473), Expect = 4.856e-47
Identity = 97/158 (61.39%), Postives = 113/158 (71.52%), Query Frame = 2
Query:   38 MSLIPSIFGGRRTNVFDPVSLDVWDPFDGFLSSALTNAPSS-ARETSQFANARIDWKETAQAHVFKADLPGLRXXXXXXXXXXGRILQISGERSKEHEEKNDKWHRVQRSSGKFLRRFRLPDNAKVEQVKASMENGVLTVTXXXXXXXXXXXXAIEIS 508
            MSLIPS FGGRR++VFDP SLDVWDPF  F        PSS + E S F + R+DWKET +AHVFKAD+PGL+          GR+LQISGER+ E E+KND WHRV+RSSGK +RRFRLP+NAKV+QVKASMENGVLTVT            AI+IS
Sbjct:    1 MSLIPSFFGGRRSSVFDPFSLDVWDPFKDF------PFPSSLSAENSAFVSTRVDWKETPEAHVFKADIPGLKKEEVKLEIQDGRVLQISGERNVEKEDKNDTWHRVERSSGKLVRRFRLPENAKVDQVKASMENGVLTVTVPKEEIKKPDVKAIDIS 152          
BLAST of CX293877 vs. ExPASy Swiss-Prot
Match: HSP14_SOYBN (17.5 kDa class I heat shock protein OS=Glycine max GN=HSP17.5-E PE=3 SV=1)

HSP 1 Score: 184.496 bits (467), Expect = 2.410e-46
Identity = 95/159 (59.75%), Postives = 111/159 (69.81%), Query Frame = 2
Query:   38 MSLIPSIFGGRRTNVFDPVSLDVWDPFDGFLSSALTNAPSSA--RETSQFANARIDWKETAQAHVFKADLPGLRXXXXXXXXXXGRILQISGERSKEHEEKNDKWHRVQRSSGKFLRRFRLPDNAKVEQVKASMENGVLTVTXXXXXXXXXXXXAIEIS 508
            MSLIP  FGGRR+NVFDP SLD+WDPF  F      + P+S+   E S F + R+DWKET +AHVFKAD+PGL+           R+LQISGER+ E E+KND WHRV+RSSGKF RRFRLP+NAKV +VKASMENGVLTVT            AIEIS
Sbjct:    1 MSLIPGFFGGRRSNVFDPFSLDMWDPFKDF------HVPTSSVSAENSAFVSTRVDWKETPEAHVFKADIPGLKKEEVKVQIEDDRVLQISGERNVEKEDKNDTWHRVERSSGKFTRRFRLPENAKVNEVKASMENGVLTVTVPKEEVKKPDVKAIEIS 153          
The following BLAST results are available for this feature:
BLAST of CX293877 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 55
Match NameE-valueIdentityDescription
HSP17_ARATH2.036e-5363.6917.4 kDa class I heat shock protein OS=Arabidopsis... [more]
HS181_ARATH2.251e-5264.7818.1 kDa class I heat shock protein OS=Arabidopsis... [more]
HS17C_ARATH2.251e-5265.8217.6 kDa class I heat shock protein 3 OS=Arabidops... [more]
HSP11_DAUCA6.129e-5062.4217.8 kDa class I heat shock protein OS=Daucus caro... [more]
HSP16_SOYBN3.042e-4962.3518.5 kDa class I heat shock protein OS=Glycine max... [more]
HSP13_SOYBN2.575e-4862.6617.5 kDa class I heat shock protein OS=Glycine max... [more]
HSP12_MEDSA3.363e-4859.8718.2 kDa class I heat shock protein OS=Medicago sa... [more]
HSP11_PEA5.736e-4861.1518.1 kDa class I heat shock protein OS=Pisum sativ... [more]
HSP11_SOYBN4.856e-4761.3917.3 kDa class I heat shock protein OS=Glycine max... [more]
HSP14_SOYBN2.410e-4659.7517.5 kDa class I heat shock protein OS=Glycine max... [more]

Pages

back to top
Libraries
Library NameType
FlavRip1cdna_library
Properties
Property NameValue
Genbank descriptionC05002A02SK FlavRip1 Citrus clementina cDNA clone C05002A02, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CX293877 ID=CX293877|Name=CX293877|organism=Citrus clementina|type=EST|length=509bp
GTTGTTGAGCATTTAATTAGCGTCCCAGTTTGCCATAATGTCACTCATTC
CAAGCATCTTCGGGGGCCGAAGAACCAACGTGTTCGATCCAGTTTCATTA
GATGTATGGGATCCTTTCGACGGGTTCTTGTCCTCTGCCCTTACCAACGC
GCCGTCTTCGGCTAGGGAAACATCCCAATTCGCCAATGCAAGAATTGACT
GGAAAGAGACTGCTCAGGCTCACGTATTCAAAGCTGATCTTCCAGGGCTG
AGGAAAGAAGAAGTAAAAGTTGAGGTTGAAGAGGGCAGGATTCTGCAGAT
AAGCGGCGAGAGGAGCAAGGAGCATGAAGAGAAGAATGACAAGTGGCATC
GCGTCCAGAGGAGCAGTGGCAAGTTCCTGAGGAGGTTCAGGTTGCCCGAC
AATGCTAAGGTGGAACAGGTTAAGGCCAGCATGGAGAATGGTGTGCTCAC
AGTCACCGTTCCTAAACAGGAGGAGAAGAAACCTGAAGTTAAGGCTATTG
AGATCTCTG
back to top