CX293884

Overview
NameCX293884
Unique NameCX293884
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length563
Libraries
Library NameType
FlavRip1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of CX293884 vs. ExPASy Swiss-Prot
Match: SRG1_ARATH (Protein SRG1 OS=Arabidopsis thaliana GN=SRG1 PE=2 SV=1)

HSP 1 Score: 84.3445 bits (207), Expect = 4.338e-16
Identity = 37/85 (43.53%), Postives = 54/85 (63.53%), Query Frame = 2
Query:    5 KSDGEWARVKPIPNSYIINIGDCIQVWSNDAYETVEHRVVVNSEKERLSIPILFNPSHYTMMKPLDELINEQNPAKYRAYNWGKY 259
            K DG+W  VKP+PN++I+NIGD +++ +N  Y ++EHR VVNSEKERLSI    N   Y  + P   L+  Q  A+++     +Y
Sbjct:  254 KKDGKWVPVKPLPNAFIVNIGDVLEIITNGTYRSIEHRGVVNSEKERLSIATFHNVGMYKEVGPAKSLVERQKVARFKRLTMKEY 338          
BLAST of CX293884 vs. ExPASy Swiss-Prot
Match: NCS1_COPJA (S-norcoclaurine synthase 1 OS=Coptis japonica GN=NCS1 PE=1 SV=1)

HSP 1 Score: 82.8037 bits (203), Expect = 1.262e-15
Identity = 40/102 (39.22%), Postives = 66/102 (64.71%), Query Frame = 2
Query:    5 KSDGEWARVKPIPNSYIINIGDCIQVWSNDAYETVEHRVVVNSEKERLSIPILFNPSHYTMMKPLDELINEQNPAKYRAYNWGKYFTSRLNSNLKKLDVENL 310
            K D +W  +KPI  ++++NIGD I++ SN  Y+++EHR V+N++KERLSI    +P + T + PL +L+ E N  KY+  ++  Y    + S+  KLD ++L
Sbjct:  249 KKDEKWVPIKPILGAFVVNIGDVIEIMSNGIYKSIEHRAVINTDKERLSIAAFHDPEYGTKIGPLPDLVKE-NGVKYKTIDYEDYL---IRSSNIKLDGKSL 346          
BLAST of CX293884 vs. ExPASy Swiss-Prot
Match: FLS_EUSGR (Flavonol synthase/flavanone 3-hydroxylase OS=Eustoma grandiflorum GN=FLS PE=2 SV=1)

HSP 1 Score: 80.4925 bits (197), Expect = 6.264e-15
Identity = 36/89 (40.45%), Postives = 55/89 (61.80%), Query Frame = 2
Query:   11 DGEWARVKPIPNSYIINIGDCIQVWSNDAYETVEHRVVVNSEKERLSIPILFNPSHYTMMKPLDELINEQNPAKYRAYNWGKYFTSRLN 277
            DG W   K IPN+ I++IGD +++ SN  Y++V HR  VN EK R+S P+   P     + P+ +L+NE+NPAK++   +  Y   +LN
Sbjct:  242 DGHWYDCKYIPNALIVHIGDQVEIMSNGKYKSVYHRTTVNKEKTRMSWPVFLEPPPDHEVGPIPKLVNEENPAKFKTKKYKDYAYCKLN 330          
BLAST of CX293884 vs. ExPASy Swiss-Prot
Match: FLS_CITUN (Flavonol synthase/flavanone 3-hydroxylase OS=Citrus unshiu GN=FLS PE=1 SV=1)

HSP 1 Score: 79.337 bits (194), Expect = 1.396e-14
Identity = 36/89 (40.45%), Postives = 55/89 (61.80%), Query Frame = 2
Query:   11 DGEWARVKPIPNSYIINIGDCIQVWSNDAYETVEHRVVVNSEKERLSIPILFNPSHYTMMKPLDELINEQNPAKYRAYNWGKYFTSRLN 277
            D  W   K IPN+ +I+IGD I++ SN  Y+ V HR  VN +K R+S P+   P   T++ PL +L++++NP KY+A  +  Y   +LN
Sbjct:  243 DDRWIDAKYIPNALVIHIGDQIEILSNGKYKAVLHRTTVNKDKTRMSWPVFLEPPADTVVGPLPQLVDDENPPKYKAKKFKDYSYCKLN 331          
BLAST of CX293884 vs. ExPASy Swiss-Prot
Match: FLS_PETCR (Flavonol synthase/flavanone 3-hydroxylase OS=Petroselinum crispum GN=FLS PE=1 SV=1)

HSP 1 Score: 78.5666 bits (192), Expect = 2.380e-14
Identity = 36/89 (40.45%), Postives = 54/89 (60.67%), Query Frame = 2
Query:   11 DGEWARVKPIPNSYIINIGDCIQVWSNDAYETVEHRVVVNSEKERLSIPILFNPSHYTMMKPLDELINEQNPAKYRAYNWGKYFTSRLN 277
            D  W  VK IPN+ II+IGD I++ SN  Y++V HR  VN +K R+S P+   P    +  P+ +LI ++NPAK++   +  Y   +LN
Sbjct:  245 DDHWYDVKYIPNALIIHIGDQIEIMSNGKYKSVYHRTTVNKDKTRMSWPVFLEPPPELLTGPISKLITDENPAKFKTKKYKDYVYCKLN 333          
BLAST of CX293884 vs. ExPASy Swiss-Prot
Match: FLS_SOLTU (Flavonol synthase/flavanone 3-hydroxylase OS=Solanum tuberosum PE=2 SV=1)

HSP 1 Score: 77.411 bits (189), Expect = 5.303e-14
Identity = 36/89 (40.45%), Postives = 52/89 (58.43%), Query Frame = 2
Query:   11 DGEWARVKPIPNSYIINIGDCIQVWSNDAYETVEHRVVVNSEKERLSIPILFNPSHYTMMKPLDELINEQNPAKYRAYNWGKYFTSRLN 277
            DG W  V  IPN+ I++IGD +++ SN  Y++V HR  VN  K R+S P+   PS    + P+  LINE NP K++   +  Y   +LN
Sbjct:  257 DGHWYDVNYIPNAIIVHIGDQVEILSNGKYKSVYHRTTVNKYKTRMSWPVFLEPSSEHEVGPIPNLINEANPPKFKTKKYKDYVYCKLN 345          
BLAST of CX293884 vs. ExPASy Swiss-Prot
Match: FLS_PETHY (Flavonol synthase/flavanone 3-hydroxylase OS=Petunia hybrida GN=FL PE=2 SV=1)

HSP 1 Score: 76.6406 bits (187), Expect = 9.046e-14
Identity = 34/89 (38.20%), Postives = 54/89 (60.67%), Query Frame = 2
Query:   11 DGEWARVKPIPNSYIINIGDCIQVWSNDAYETVEHRVVVNSEKERLSIPILFNPSHYTMMKPLDELINEQNPAKYRAYNWGKYFTSRLN 277
            DG W  VK IPN+ I++IGD +++ SN  Y++V HR  VN +K R+S P+   P     + P+ +L++E NP K++   +  Y   +LN
Sbjct:  256 DGHWYDVKYIPNALIVHIGDQVEILSNGKYKSVYHRTTVNKDKTRMSWPVFLEPPSEHEVGPIPKLLSEANPPKFKTKKYKDYVYCKLN 344          
BLAST of CX293884 vs. ExPASy Swiss-Prot
Match: FLS_MALDO (Flavonol synthase/flavanone 3-hydroxylase OS=Malus domestica GN=FLS PE=2 SV=1)

HSP 1 Score: 74.3294 bits (181), Expect = 4.489e-13
Identity = 34/89 (38.20%), Postives = 52/89 (58.43%), Query Frame = 2
Query:   11 DGEWARVKPIPNSYIINIGDCIQVWSNDAYETVEHRVVVNSEKERLSIPILFNPSHYTMMKPLDELINEQNPAKYRAYNWGKYFTSRLN 277
            DG W  VK IPN+ +I+IGD +++ SN  Y +V HR  VN +K R+S P+   P    ++ P  +L+N  N  KY+   +G Y   ++N
Sbjct:  245 DGRWYDVKYIPNALVIHIGDQMEIMSNGKYTSVLHRTTVNKDKTRISWPVFLEPPADHVVGPHPQLVNAVNQPKYKTKKYGDYVYCKIN 333          
BLAST of CX293884 vs. ExPASy Swiss-Prot
Match: ACCH3_SOLLC (1-aminocyclopropane-1-carboxylate oxidase homolog OS=Solanum lycopersicum GN=ACO3 PE=2 SV=1)

HSP 1 Score: 73.559 bits (179), Expect = 7.658e-13
Identity = 36/77 (46.75%), Postives = 47/77 (61.04%), Query Frame = 2
Query:   20 WARVKPIPNSYIINIGDCIQVWSNDAYETVEHRVVVNSEKERLSIPILFNPSHYTMMK---PLDELINEQNPAKYRA 241
            W  V P P S ++NIGD +Q+ SND Y +VEHR + N+   R+SI   F  S Y   K   P+ EL++E NP KYRA
Sbjct:  261 WVDVPPTPGSLVVNIGDFLQLLSNDKYLSVEHRAISNNVGSRMSITCFFGESPYQSSKLYGPITELLSEDNPPKYRA 337          
BLAST of CX293884 vs. ExPASy Swiss-Prot
Match: HY6H_HYONI (Hyoscyamine 6-dioxygenase OS=Hyoscyamus niger GN=H6H PE=1 SV=1)

HSP 1 Score: 70.8626 bits (172), Expect = 4.964e-12
Identity = 28/83 (33.73%), Postives = 53/83 (63.86%), Query Frame = 2
Query:   11 DGEWARVKPIPNSYIINIGDCIQVWSNDAYETVEHRVVVNSEKERLSIPILFNPSHYTMMKPLDELINEQNPAKYRAYNWGKY 259
            D  W  V+PIP ++++N+G  ++V +N+ +E   HRVV +  ++R+SI  L  P +   ++P  EL+N+ NP  Y+ Y++ ++
Sbjct:  240 DATWIAVQPIPTAFVVNLGLTLKVITNEKFEGSIHRVVTDPTRDRVSIATLIGPDYSCTIEPAKELLNQDNPPLYKPYSYSEF 322          
The following BLAST results are available for this feature:
BLAST of CX293884 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 15
Match NameE-valueIdentityDescription
SRG1_ARATH4.338e-1643.53Protein SRG1 OS=Arabidopsis thaliana GN=SRG1 PE=2 ... [more]
NCS1_COPJA1.262e-1539.22S-norcoclaurine synthase 1 OS=Coptis japonica GN=N... [more]
FLS_EUSGR6.264e-1540.45Flavonol synthase/flavanone 3-hydroxylase OS=Eusto... [more]
FLS_CITUN1.396e-1440.45Flavonol synthase/flavanone 3-hydroxylase OS=Citru... [more]
FLS_PETCR2.380e-1440.45Flavonol synthase/flavanone 3-hydroxylase OS=Petro... [more]
FLS_SOLTU5.303e-1440.45Flavonol synthase/flavanone 3-hydroxylase OS=Solan... [more]
FLS_PETHY9.046e-1438.20Flavonol synthase/flavanone 3-hydroxylase OS=Petun... [more]
FLS_MALDO4.489e-1338.20Flavonol synthase/flavanone 3-hydroxylase OS=Malus... [more]
ACCH3_SOLLC7.658e-1346.751-aminocyclopropane-1-carboxylate oxidase homolog ... [more]
HY6H_HYONI4.964e-1233.73Hyoscyamine 6-dioxygenase OS=Hyoscyamus niger GN=H... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC05002B01SK FlavRip1 Citrus clementina cDNA clone C05002B01, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CX293884 ID=CX293884|Name=CX293884|organism=Citrus clementina|type=EST|length=563bp
GAAAAAATCAGACGGAGAATGGGCTCGCGTCAAACCCATCCCGAATTCTT
ATATCATAAATATCGGTGATTGTATTCAGGTATGGAGCAATGATGCTTAT
GAGACTGTGGAGCATAGGGTTGTGGTGAATTCTGAGAAGGAAAGGCTTTC
AATTCCAATTTTATTCAACCCATCTCATTACACAATGATGAAGCCATTAG
ATGAGCTTATAAATGAGCAAAATCCTGCTAAATACAGAGCATACAATTGG
GGAAAATATTTTACTTCTAGATTGAACAGCAATTTGAAGAAGCTTGATGT
TGAGAACCTTCAAATTTATCATTTCAAGGTACAAGAGTCAGCCAATAAGC
TGGATGGACTACTCTCTATTAACAAGTAATTAATTTAGTTATAAATTCCC
ACACCTATTGTGTTTCATCTTCGAATTCTACCTATATGTGAATATATTAT
GTCATGGGAATAATGGAATTTGCAATAATGTCATCTGCTAGTTGGTGTCA
GTGTCTCACATTAATAAATATTATTTCCGTAATGTGAAATCAATAAAAAA
AAAAAAAAAAAAA
back to top