CX294035
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of CX294035 vs. ExPASy Swiss-Prot
Match: PCKA_CUCSA (Phosphoenolpyruvate carboxykinase [ATP] OS=Cucumis sativus GN=PCK PE=2 SV=1) HSP 1 Score: 89.7373 bits (221), Expect = 7.301e-18 Identity = 41/46 (89.13%), Postives = 45/46 (97.83%), Query Frame = 1 Query: 1 VKYEKGSFITSSGALATLSGAKTGRSPRDKRVVKDETTERELWWGK 138 +KYEKGSFITS+GALATLSGAKTGRSP DKRVVKD+TTE+ELWWGK Sbjct: 164 IKYEKGSFITSTGALATLSGAKTGRSPIDKRVVKDDTTEKELWWGK 209
BLAST of CX294035 vs. ExPASy Swiss-Prot
Match: PCKA_MAIZE (Phosphoenolpyruvate carboxykinase [ATP] OS=Zea mays PE=2 SV=1) HSP 1 Score: 88.1965 bits (217), Expect = 2.124e-17 Identity = 40/46 (86.96%), Postives = 44/46 (95.65%), Query Frame = 1 Query: 1 VKYEKGSFITSSGALATLSGAKTGRSPRDKRVVKDETTERELWWGK 138 +KYEKGSFITS+GALATLSGAKTGRSPRDKRVVKDE T ++LWWGK Sbjct: 161 IKYEKGSFITSTGALATLSGAKTGRSPRDKRVVKDEVTAQDLWWGK 206
BLAST of CX294035 vs. ExPASy Swiss-Prot
Match: PCKA_ARATH (Phosphoenolpyruvate carboxykinase [ATP] OS=Arabidopsis thaliana GN=PCKA PE=1 SV=1) HSP 1 Score: 87.8113 bits (216), Expect = 2.774e-17 Identity = 40/46 (86.96%), Postives = 44/46 (95.65%), Query Frame = 1 Query: 1 VKYEKGSFITSSGALATLSGAKTGRSPRDKRVVKDETTERELWWGK 138 +KYEKGSFITS+GALATLSGAKTGR+PRDKRVV+D TTE ELWWGK Sbjct: 165 IKYEKGSFITSNGALATLSGAKTGRAPRDKRVVRDATTEDELWWGK 210
BLAST of CX294035 vs. ExPASy Swiss-Prot
Match: PCKA2_UROPA (Phosphoenolpyruvate carboxykinase [ATP] 2 OS=Urochloa panicoides GN=PCK2 PE=2 SV=1) HSP 1 Score: 82.0333 bits (201), Expect = 1.522e-15 Identity = 38/43 (88.37%), Postives = 41/43 (95.35%), Query Frame = 1 Query: 10 EKGSFITSSGALATLSGAKTGRSPRDKRVVKDETTERELWWGK 138 +K SFITS+GALATLSGAKTGRSPRDKRVVKDETT +ELWWGK Sbjct: 123 KKSSFITSTGALATLSGAKTGRSPRDKRVVKDETTSQELWWGK 165
BLAST of CX294035 vs. ExPASy Swiss-Prot
Match: PCKA1_UROPA (Phosphoenolpyruvate carboxykinase [ATP] 1 OS=Urochloa panicoides GN=PCK1 PE=1 SV=1) HSP 1 Score: 80.4925 bits (197), Expect = 4.429e-15 Identity = 37/43 (86.05%), Postives = 41/43 (95.35%), Query Frame = 1 Query: 10 EKGSFITSSGALATLSGAKTGRSPRDKRVVKDETTERELWWGK 138 +K SFITS+GALATLSGAKTGRSPRDKRVVKD+TT +ELWWGK Sbjct: 121 KKSSFITSTGALATLSGAKTGRSPRDKRVVKDDTTAQELWWGK 163
BLAST of CX294035 vs. ExPASy Swiss-Prot
Match: PCKA_EMENI (Phosphoenolpyruvate carboxykinase [ATP] OS=Emericella nidulans GN=acuF PE=3 SV=2) HSP 1 Score: 69.707 bits (169), Expect = 7.819e-12 Identity = 30/43 (69.77%), Postives = 37/43 (86.05%), Query Frame = 1 Query: 7 YEKGSFITSSGALATLSGAKTGRSPRDKRVVKDETTERELWWG 135 YE G+ ITSSGAL SGAKTGRSP DKR+VK+E++E+E+WWG Sbjct: 58 YETGTAITSSGALTAYSGAKTGRSPSDKRIVKEESSEKEVWWG 100 The following BLAST results are available for this feature:
BLAST of CX294035 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 6
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >CX294035 ID=CX294035; Name=CX294035; organism=Citrus clementina; type=EST; length=486bpback to top |