CX294813

Overview
NameCX294813
Unique NameCX294813
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length590
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig14254 contig Ccv1_Contig14254:1194..1783. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CX294813 vs. ExPASy Swiss-Prot
Match: CSLH3_ORYSJ (Putative cellulose synthase-like protein H3 OS=Oryza sativa subsp. japonica GN=CSLH3 PE=3 SV=3)

HSP 1 Score: 193.356 bits (490), Expect = 7.290e-49
Identity = 93/181 (51.38%), Postives = 116/181 (64.09%), Query Frame = 3
Query:   45 NISRSLDEAHRVADCGYEYGSSWGDEVGCLYGATAEDNLTGLVIHSKGWRSGYCLPIPHAFLGCASPSGPAGMRQQKRWATGLLEILFSKRNPILATLIGKLQFRQCLAYLWILTWGLRSIPELCYIALPAYCIITNSTFLPKVQEPTVLIPLALFLIYKLYTLLEYIQAGLSIRSWWVNN 587
            +IS  ++ A  V+ C YE G+ WG EVG  YG+  ED LTG  IH+ GWRS      P AFLGCA   GPA + Q KRWATGL EIL S+ NP+L ++   LQFRQCLAYL +  W +R   ELCY  L  YC++TN +FL K  E    I LALFL Y  Y  +EY++ GLS+R+WW N+
Sbjct:  465 DISSHIEVAKEVSSCNYESGTHWGLEVGWAYGSMTEDILTGQRIHAAGWRSAKLETEPPAFLGCAPTGGPACLTQFKRWATGLFEILISQNNPLLLSIFKHLQFRQCLAYLTLYVWAVRGFVELCYELLVPYCLLTNQSFLSKASENCFNITLALFLTYNTYNFVEYMECGLSVRAWWNNH 645          
BLAST of CX294813 vs. ExPASy Swiss-Prot
Match: CSLH2_ORYSJ (Cellulose synthase-like protein H2 OS=Oryza sativa subsp. japonica GN=CSLH2 PE=2 SV=3)

HSP 1 Score: 192.586 bits (488), Expect = 1.243e-48
Identity = 93/181 (51.38%), Postives = 120/181 (66.30%), Query Frame = 3
Query:   45 NISRSLDEAHRVADCGYEYGSSWGDEVGCLYGATAEDNLTGLVIHSKGWRSGYCLPIPHAFLGCASPSGPAGMRQQKRWATGLLEILFSKRNPILATLIGKLQFRQCLAYLWILTWGLRSIPELCYIALPAYCIITNSTFLPKVQEPTVLIPLALFLIYKLYTLLEYIQAGLSIRSWWVNN 587
            +IS  ++ A  V+ C Y+ G+ WG EVG +YG+  ED LTG  IH+ GWRS   +  P AF+G A   GPA + Q KRWATG  EI+ S+ NPILAT+  +L+FRQCLAYL +L W LR+  ELCY  L  YCI+TN +FLPK  E    +PLALF+ Y  Y  +EY+  GLS R+WW N+
Sbjct:  434 DISSRIEVAKAVSACNYDIGTCWGQEVGWVYGSLTEDILTGQRIHAMGWRSVLMVTEPPAFMGSAPIGGPACLTQFKRWATGQSEIIISRNNPILATMFKRLKFRQCLAYLIVLGWPLRAPFELCYGLLGPYCILTNQSFLPKASEDGFSVPLALFISYNTYNFMEYMACGLSARAWWNNH 614          
BLAST of CX294813 vs. ExPASy Swiss-Prot
Match: CSLH2_ORYSI (Cellulose synthase-like protein H2 OS=Oryza sativa subsp. indica GN=CSLH2 PE=2 SV=1)

HSP 1 Score: 192.586 bits (488), Expect = 1.243e-48
Identity = 93/181 (51.38%), Postives = 120/181 (66.30%), Query Frame = 3
Query:   45 NISRSLDEAHRVADCGYEYGSSWGDEVGCLYGATAEDNLTGLVIHSKGWRSGYCLPIPHAFLGCASPSGPAGMRQQKRWATGLLEILFSKRNPILATLIGKLQFRQCLAYLWILTWGLRSIPELCYIALPAYCIITNSTFLPKVQEPTVLIPLALFLIYKLYTLLEYIQAGLSIRSWWVNN 587
            +IS  ++ A  V+ C Y+ G+ WG EVG +YG+  ED LTG  IH+ GWRS   +  P AF+G A   GPA + Q KRWATG  EI+ S+ NPILAT+  +L+FRQCLAYL +L W LR+  ELCY  L  YCI+TN +FLPK  E    +PLALF+ Y  Y  +EY+  GLS R+WW N+
Sbjct:  434 DISSRIEVAKAVSACNYDIGTCWGQEVGWVYGSLTEDILTGQRIHAMGWRSVLMVTEPPAFMGSAPIGGPACLTQFKRWATGQSEIIISRNNPILATMFKRLKFRQCLAYLIVLGWPLRAPFELCYGLLGPYCILTNQSFLPKASEDGFSVPLALFISYNTYNFMEYMACGLSARAWWNNH 614          
BLAST of CX294813 vs. ExPASy Swiss-Prot
Match: CSLB4_ARATH (Cellulose synthase-like protein B4 OS=Arabidopsis thaliana GN=CSLB4 PE=2 SV=1)

HSP 1 Score: 187.578 bits (475), Expect = 4.000e-47
Identity = 91/179 (50.84%), Postives = 119/179 (66.48%), Query Frame = 3
Query:   45 NISRSLDEAHRVADCGYEYGSSWGDEVGCLYGATAEDNLTGLVIHSKGWRSGYCLPIPHAFLGCASPSGPAGMRQQKRWATGLLEILFSKRNPILATLIGKLQFRQCLAYLWILTWGLRSIPELCYIALPAYCIITNSTFLPKVQEPTVLIPLALFLIYKLYTLLEYIQAGLSIRSWWV 581
            N+  SL+ A  +  C YEY +SWG  +G LY +T ED  T + IHS+GW S Y  P P AFLGC    GP  M QQ+RWATGLLEILF+K++P++     K++FRQ LAYL++ +WGLRSIPEL Y  LPAYC++ NS   PK     ++I   L  I+ LYTL E++  G SI+SW+V
Sbjct:  425 NLKDSLETAQEMGHCHYEYQTSWGKNIGWLYDSTTEDVNTSIGIHSRGWTSSYIFPDPPAFLGCMPQGGPEVMVQQRRWATGLLEILFNKQSPLIGMFCRKIRFRQSLAYLYVFSWGLRSIPELFYCLLPAYCLLHNSALFPKGVYLGIII--TLVGIHCLYTLWEFMNLGFSIQSWYV 601          
BLAST of CX294813 vs. ExPASy Swiss-Prot
Match: CSLH1_ORYSJ (Cellulose synthase-like protein H1 OS=Oryza sativa subsp. japonica GN=CSLH1 PE=2 SV=2)

HSP 1 Score: 185.652 bits (470), Expect = 1.520e-46
Identity = 92/181 (50.83%), Postives = 114/181 (62.98%), Query Frame = 3
Query:   45 NISRSLDEAHRVADCGYEYGSSWGDEVGCLYGATAEDNLTGLVIHSKGWRSGYCLPIPHAFLGCASPSGPAGMRQQKRWATGLLEILFSKRNPILATLIGKLQFRQCLAYLWILTWGLRSIPELCYIALPAYCIITNSTFLPKVQEPTVLIPLALFLIYKLYTLLEYIQAGLSIRSWWVNN 587
            +IS  +D A  VA C YE G+ WG EVG +YG+  ED LTG  IH+ GWRS      P AF+GCA   GPA + Q KRWA+G LEIL S+ NPIL T    LQFRQCLAYL    W +R+  ELCY  L  YC+++N +FLPK  E    I LALF+ Y  Y  +E+I+ G S R+ W N+
Sbjct:  423 DISSCVDVAKEVAACNYEIGTCWGQEVGWVYGSLTEDVLTGQRIHAAGWRSTLMEIEPPAFMGCAPNGGPACLTQLKRWASGFLEILISRNNPILTTTFKSLQFRQCLAYLHSYVWPVRAPFELCYALLGPYCLLSNQSFLPKTSEDGFYIALALFIAYNTYMFMEFIECGQSARACWNNH 603          
BLAST of CX294813 vs. ExPASy Swiss-Prot
Match: CSLB3_ARATH (Cellulose synthase-like protein B3 OS=Arabidopsis thaliana GN=CSLB3 PE=2 SV=1)

HSP 1 Score: 183.341 bits (464), Expect = 7.544e-46
Identity = 86/181 (47.51%), Postives = 121/181 (66.85%), Query Frame = 3
Query:   42 SNISRSLDEAHRVADCGYEYGSSWGDEVGCLYGATAEDNLTGLVIHSKGWRSGYCLPIPHAFLGCASPSGPAGMRQQKRWATGLLEILFSKRNPILATLIGKLQFRQCLAYLWILTWGLRSIPELCYIALPAYCIITNSTFLPKVQEPTVLIPLALFLIYKLYTLLEYIQAGLSIRSWWVN 584
            + ++ SL+ A  V  C +EY +SWG  +G LY +TAED  T + IHS+GW S Y  P P AFLG   P GP  M QQ+RWATGLLE+LF+K++P++     K++FRQ LAYL+I TWGLRSIPEL Y  LPAYC++ N+   PK     +++   L  ++ LY+L E++  G S++SW+ +
Sbjct:  424 NTLANSLEAAQEVGHCHFEYQTSWGKTIGWLYESTAEDANTSIGIHSRGWTSSYISPKPPAFLGAMPPGGPEAMLQQRRWATGLLEVLFNKQSPLIGMFCRKIRFRQSLAYLYIFTWGLRSIPELIYCLLPAYCLLHNAALFPKGVYLGIVV--TLVGMHCLYSLWEFMSLGFSVQSWFAS 602          
BLAST of CX294813 vs. ExPASy Swiss-Prot
Match: CSLB1_ARATH (Cellulose synthase-like protein B1 OS=Arabidopsis thaliana GN=CSLB1 PE=2 SV=2)

HSP 1 Score: 158.688 bits (400), Expect = 1.990e-38
Identity = 84/179 (46.93%), Postives = 114/179 (63.69%), Query Frame = 3
Query:   48 ISRSLDEAHRVADCGYEYGSSWGDEVGCLYGATAEDNLTGLVIHSKGWRSGYCLPIPHAFLGCASPSGPAGMRQQKRWATGLLEILFSKRNPILATLIGKLQFRQCLAYLWILTWGLRSIPELCYIALPAYCIITNSTFLPKVQEPTVLIPLALFLIYKLYTLLEYIQAGLSIRSWWVN 584
            ++ S++ A  V  C YEY +SWG+ +G LY + AED  T + IHS+GW S Y  P   AFLG      P  + QQ+RWATG +EILF+K++P+      K++FRQ LAYL I+T  LRSIPEL Y  LPAYC++ NST  PK     + I + L  I+ LYTL E++  G S++SW V+
Sbjct:  427 LTNSIEAAREVGHCQYEYQTSWGNTIGWLYDSVAEDLNTSIGIHSRGWTSSYISPDTPAFLGSMPAGVPEALLQQRRWATGWIEILFNKQSPLRGLFSKKIRFRQRLAYLCIITC-LRSIPELIYCLLPAYCLLHNSTLFPK--GLYLGITVTLVGIHCLYTLWEFMSLGYSVQSWLVS 602          
BLAST of CX294813 vs. ExPASy Swiss-Prot
Match: CSLB2_ARATH (Cellulose synthase-like protein B2 OS=Arabidopsis thaliana GN=CSLB2 PE=2 SV=1)

HSP 1 Score: 154.066 bits (388), Expect = 4.901e-37
Identity = 81/179 (45.25%), Postives = 114/179 (63.69%), Query Frame = 3
Query:   48 ISRSLDEAHRVADCGYEYGSSWGDEVGCLYGATAEDNLTGLVIHSKGWRSGYCLPIPHAFLGCASPSGPAGMRQQKRWATGLLEILFSKRNPILATLIGKLQFRQCLAYLWILTWGLRSIPELCYIALPAYCIITNSTFLPKVQEPTVLIPLALFLIYKLYTLLEYIQAGLSIRSWWVN 584
            ++ S++ A  V  C YE  +SWG  +G LY + +ED  T + IHS+GW S Y  P P AFLG   P G   M QQ+RWATG +E+LF+K++P+L     KL+FRQ +AYL + +  +RSIPEL Y  LPAYC++ NS   PK     + I + L  ++ LYTL E++  G SI+SW+V+
Sbjct:  426 LTNSIEAAQEVGHCDYESQTSWGKTIGWLYDSMSEDMNTSIGIHSRGWTSSYIAPDPPAFLGSMPPGGLEAMIQQRRWATGSIEVLFNKQSPLLGLFCRKLRFRQRVAYLCV-SICVRSIPELIYCLLPAYCLLHNSALFPK--GLCLGITMLLAGMHCLYTLWEFMCLGHSIQSWYVS 601          
BLAST of CX294813 vs. ExPASy Swiss-Prot
Match: CSLB6_ARATH (Cellulose synthase-like protein B6 OS=Arabidopsis thaliana GN=CSLB6 PE=2 SV=2)

HSP 1 Score: 150.599 bits (379), Expect = 5.419e-36
Identity = 77/180 (42.78%), Postives = 115/180 (63.89%), Query Frame = 3
Query:   45 NISRSLDEAHRVADCGYEYGSSWGDEVGCLYGATAEDNLTGLVIHSKGWRSGYCLPIPHAFLGCASPSGPAGMRQQKRWATGLLEILFSKRNPILATLIGKLQFRQCLAYLWILTWGLRSIPELCYIALPAYCIITNSTFLPKVQEPTVLIPLALFLIYKLYTLLEYIQAGLSIRSWWVN 584
            +++  ++ A  V  C YEY +SWG+ +G LY + AED  T + IH +GW S +  P P AFLG     GP  + Q +RWATG +E+LF+K++P++     K++FRQ LAY W+L   +RSIPEL Y  LPAYC++ NS   PK   P + I + L  ++ LYTL +++  G S++SW+V+
Sbjct:  425 SLANLVEAAQEVGHCHYEYQTSWGN-LGWLYDSVAEDTNTSIGIHLRGWTSSFISPDPPAFLGSTPSVGPEAIVQHRRWATGSIEVLFNKQSPLIG-FRRKIKFRQRLAYFWVLMC-IRSIPELVYCLLPAYCLLNNSALFPK--GPCLGIIVTLVGMHCLYTLWQFMILGFSVKSWYVS 599          
BLAST of CX294813 vs. ExPASy Swiss-Prot
Match: CSLB5_ARATH (Cellulose synthase-like protein B5 OS=Arabidopsis thaliana GN=CSLB5 PE=2 SV=2)

HSP 1 Score: 147.517 bits (371), Expect = 4.587e-35
Identity = 74/179 (41.34%), Postives = 112/179 (62.57%), Query Frame = 3
Query:   45 NISRSLDEAHRVADCGYEYGSSWGDEVGCLYGATAEDNLTGLVIHSKGWRSGYCLPIPHAFLGCASPSGPAGMRQQKRWATGLLEILFSKRNPILATLIGKLQFRQCLAYLWILTWGLRSIPELCYIALPAYCIITNSTFLPKVQEPTVLIPLALFLIYKLYTLLEYIQAGLSIRSWWV 581
            +++  ++ A  V  C YEY +SWG+ +G +Y + AED  T + IH +GW S +  P P AF+G     G   + QQ+RWATG +E+LF+K++P +    GK++FRQ LAY W L   LRSIPEL Y  LPAYC++ +S   PK   P +   + L  ++ LY+L +++  G S++SW+V
Sbjct:  425 SLANLIEAAQEVGHCHYEYQTSWGN-LGWMYDSVAEDINTSVGIHLRGWTSSFISPDPPAFIGSTPTLGLEAIVQQRRWATGAIEVLFNKQSPFMGMFHGKIKFRQRLAYFWALMC-LRSIPELIYCLLPAYCLLHDSALFPK--GPCLCTIVTLVGMHCLYSLWQFMSLGFSVQSWYV 599          
The following BLAST results are available for this feature:
BLAST of CX294813 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 65
Match NameE-valueIdentityDescription
CSLH3_ORYSJ7.290e-4951.38Putative cellulose synthase-like protein H3 OS=Ory... [more]
CSLH2_ORYSJ1.243e-4851.38Cellulose synthase-like protein H2 OS=Oryza sativa... [more]
CSLH2_ORYSI1.243e-4851.38Cellulose synthase-like protein H2 OS=Oryza sativa... [more]
CSLB4_ARATH4.000e-4750.84Cellulose synthase-like protein B4 OS=Arabidopsis ... [more]
CSLH1_ORYSJ1.520e-4650.83Cellulose synthase-like protein H1 OS=Oryza sativa... [more]
CSLB3_ARATH7.544e-4647.51Cellulose synthase-like protein B3 OS=Arabidopsis ... [more]
CSLB1_ARATH1.990e-3846.93Cellulose synthase-like protein B1 OS=Arabidopsis ... [more]
CSLB2_ARATH4.901e-3745.25Cellulose synthase-like protein B2 OS=Arabidopsis ... [more]
CSLB6_ARATH5.419e-3642.78Cellulose synthase-like protein B6 OS=Arabidopsis ... [more]
CSLB5_ARATH4.587e-3541.34Cellulose synthase-like protein B5 OS=Arabidopsis ... [more]

Pages

back to top
Libraries
Library NameType
PhIFruit1cdna_library
Properties
Property NameValue
Genbank descriptionC05056C06SK PhIFruit1 Citrus clementina cDNA clone C05056C06, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CX294813 ID=CX294813|Name=CX294813|organism=Citrus clementina|type=EST|length=590bp
CTCGTGCCGAATTCGGCACGAGGAAGACAGGAGGTTATTCAAGTAACATA
TCGAGATCGCTTGATGAAGCACACCGAGTTGCAGATTGTGGTTATGAGTA
TGGTAGTAGCTGGGGTGATGAGGTGGGGTGCTTGTATGGCGCCACAGCAG
AAGATAACTTAACTGGCTTGGTGATCCATTCAAAAGGCTGGAGATCAGGC
TACTGCTTGCCGATCCCACATGCCTTTCTTGGCTGTGCGTCTCCCAGCGG
CCCTGCTGGGATGAGACAACAGAAAAGGTGGGCCACGGGACTGCTTGAAA
TCCTATTCAGCAAACGTAACCCCATATTGGCTACTCTCATCGGGAAGCTC
CAATTTCGACAATGTTTGGCTTATTTGTGGATCCTTACTTGGGGCTTGCG
CTCAATTCCCGAGCTGTGCTACATTGCCCTTCCAGCTTATTGCATCATCA
CCAACTCCACTTTCCTGCCAAAGGTCCAGGAACCAACCGTATTGATCCCT
CTTGCACTTTTTTTGATCTACAAATTATATACTCTATTAGAGTACATTCA
AGCTGGTTTATCAATCCGTTCATGGTGGGTTAACAATTGT
back to top