CX294957

Overview
NameCX294957
Unique NameCX294957
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length587
Libraries
Library NameType
DroRLeaf1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
CX294957_ssr209 microsatellite CX294957_ssr209:209..220. BLAST: Citrus ESTs to Prunus persica proteins V1
Ccv1_Contig5796 contig Ccv1_Contig5796:63..650. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CX294957 vs. ExPASy Swiss-Prot
Match: G3PA_PEA (Glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic OS=Pisum sativum GN=GAPA PE=2 SV=2)

HSP 1 Score: 251.521 bits (641), Expect = 2.229e-66
Identity = 126/167 (75.45%), Postives = 144/167 (86.23%), Query Frame = 2
Query:   47 MASATLSVAKSALQGNGKGFSEFSGLRNSAS-LPFGRKSSDDFHSVIALQTSALGSSSSGYRKVAAQAK-LKVAINGFGRIGRNFLRCWHGRKDSPLEVVAINDTGGVKQASHLLKYDSTLGIFEADVKPVGTDGISVDGKVIQVVSNRNPVNLPWGDWASTL*LKG 541
            MASAT SVAK A++ NGKGFSEFSGLRNS+  LPF RKSSDDFHS++  QT+A+GSS    + +  +AK LKVAINGFGRIGRNFLRCWHGRKDSPL+V+AINDTGGVKQASHLLKYDSTLGIF+ADVKPVGTDGISVDGKVI+VVS+RNP NLPW +    L ++G
Sbjct:    1 MASATFSVAKPAIKANGKGFSEFSGLRNSSRHLPFSRKSSDDFHSLVTFQTNAVGSSGGHKKSLVVEAKQLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTLGIFDADVKPVGTDGISVDGKVIKVVSDRNPANLPWKELGIDLVIEG 167          
BLAST of CX294957 vs. ExPASy Swiss-Prot
Match: G3PA_TOBAC (Glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic (Fragment) OS=Nicotiana tabacum GN=GAPA PE=2 SV=1)

HSP 1 Score: 239.58 bits (610), Expect = 8.766e-63
Identity = 117/155 (75.48%), Postives = 136/155 (87.74%), Query Frame = 2
Query:   77 SALQGNGKGFSEFSGLRNSASLPFGRKSSDDFHSVIALQTSALGSSSSGYRKVAAQAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVVAINDTGGVKQASHLLKYDSTLGIFEADVKPVGTDGISVDGKVIQVVSNRNPVNLPWGDWASTL*LKG 541
            S+LQ + KGFSEFSGLR S+++PFGRK++DD  SV+A QTS +G  +S  ++   +AKLKVAINGFGRIGRNFLRCWHGRKDSPL+V+AINDTGGVKQASHLLKYDSTLGIF+ADVKPVGTDGISVDGKVIQVVS+RNPVNLPWGD    L ++G
Sbjct:    2 SSLQVSNKGFSEFSGLRTSSAIPFGRKTNDDLLSVVAFQTSVIGGGNS--KRGVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTLGIFDADVKPVGTDGISVDGKVIQVVSDRNPVNLPWGDLGIDLVIEG 154          
BLAST of CX294957 vs. ExPASy Swiss-Prot
Match: G3PA_ARATH (Glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic OS=Arabidopsis thaliana GN=GAPA PE=1 SV=3)

HSP 1 Score: 221.476 bits (563), Expect = 2.470e-57
Identity = 117/167 (70.06%), Postives = 135/167 (80.84%), Query Frame = 2
Query:   47 MASATLSVAKSALQGNGKGFSEFSGLRNS-ASLPFGRK-SSDDFHSVIALQTSALGSSSSGYRKVAAQAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVVAINDTGGVKQASHLLKYDSTLGIFEADVKPVGTDGISVDGKVIQVVSNRNPVNLPWGDWASTL*LKG 541
            MAS T SV K        GF+EFSGLR+S ASLPFG+K SSD+F S+++ QTSA+GSS  GYRK   +AKLKVAINGFGRIGRNFLRCWHGRKDSPL+++AINDTGGVKQASHLLKYDSTLGIF+ADVKP G   ISVDGK+IQVVSNRNP  LPW +    + ++G
Sbjct:    1 MASVTFSVPK--------GFTEFSGLRSSSASLPFGKKLSSDEFVSIVSFQTSAMGSSG-GYRKGVTEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDIIAINDTGGVKQASHLLKYDSTLGIFDADVKPSGETAISVDGKIIQVVSNRNPSLLPWKELGIDIVIEG 158          
BLAST of CX294957 vs. ExPASy Swiss-Prot
Match: G3PA_SPIOL (Glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic OS=Spinacia oleracea GN=GAPA PE=1 SV=2)

HSP 1 Score: 218.009 bits (554), Expect = 2.731e-56
Identity = 113/165 (68.48%), Postives = 128/165 (77.58%), Query Frame = 2
Query:   47 MASATLSVAKSALQGNGKGFSEFSGLRNSASLPFGRKSSDDFHSVIALQTSALGSSSSGYRKVAAQAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVVAINDTGGVKQASHLLKYDSTLGIFEADVKPVGTDGISVDGKVIQVVSNRNPVNLPWGDWASTL*LKG 541
            MAS  LS+A  +L+   KGFSEFSGL  S SLPFGRK SDD  + ++ QT+A+G   S    V  +AKLKVAINGFGRIGRNFLRCWHGRKDSPL+VV INDTGGVKQASHLLKYDS LG F+ADVK  G   ISVDGKVI+VVS+RNPVNLPWGD    L ++G
Sbjct:    1 MASNMLSIANPSLRVYNKGFSEFSGLHTS-SLPFGRKGSDDLMAFVSFQTNAVGGKRSSQNGVV-EAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVVVINDTGGVKQASHLLKYDSILGTFDADVKTAGDSAISVDGKVIKVVSDRNPVNLPWGDMGIDLVIEG 163          
BLAST of CX294957 vs. ExPASy Swiss-Prot
Match: G3PA_MAIZE (Glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic OS=Zea mays GN=GAPA PE=2 SV=1)

HSP 1 Score: 212.231 bits (539), Expect = 1.499e-54
Identity = 114/167 (68.26%), Postives = 133/167 (79.64%), Query Frame = 2
Query:   47 MASATLSVAKSALQGNGKGFSEFSGLRNSASLPFGRKS-SDDFHSVIALQTSALGSSSSGYRKVAAQAKLKVAINGFGRIGRNFLRCWHGRKD-SPLEVVAINDTGGVKQASHLLKYDSTLGIFEADVKPVGTDGISVDGKVIQVVSNRNPVNLPWGDWASTL*LKG 541
            MAS+ LS     LQ  G G SEFSGLR+SASLP  R + SDDF S ++ +T A+G+S  G R+   +AKLKVAINGFGRIGRNFLRCWHGR D SPL+V+AINDTGGVKQASHLLKYDSTLGIF+ADVKPVG + ISVDGKVI+VVS+RNP NLPWG+    L ++G
Sbjct:    1 MASSMLSATTVPLQQGG-GLSEFSGLRSSASLPMRRNATSDDFMSAVSFRTHAVGTSG-GPRRAPTEAKLKVAINGFGRIGRNFLRCWHGRGDASPLDVIAINDTGGVKQASHLLKYDSTLGIFDADVKPVGDNAISVDGKVIKVVSDRNPSNLPWGELGIDLVIEG 165          
BLAST of CX294957 vs. ExPASy Swiss-Prot
Match: G3PB_SPIOL (Glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic OS=Spinacia oleracea GN=GAPB PE=1 SV=1)

HSP 1 Score: 166.392 bits (420), Expect = 9.431e-41
Identity = 84/145 (57.93%), Postives = 109/145 (75.17%), Query Frame = 2
Query:  107 SEFSGLRNSASLPFGRKSSDDFHSVIALQTSALGSSSSGYRKVAAQAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVVAINDTGGVKQASHLLKYDSTLGIFEADVKPVGTDGISVDGKVIQVVSNRNPVNLPWGDWASTL*LKG 541
            ++FSGLR+S S+ F R++S  FH VIA Q +   + ++  R     AKLKVAINGFGRIGRNFLRCWHGRKDSPL+VV +ND+GGVK A+HLLKYDS LG F+ADVK +  +  S+DGK I+VVSNR+P+ LPW +    + ++G
Sbjct:   40 ADFSGLRSSNSVTFTREAS--FHDVIAAQLTTKPTGAAPVRGETV-AKLKVAINGFGRIGRNFLRCWHGRKDSPLDVVVVNDSGGVKSATHLLKYDSILGTFKADVKIIDNETFSIDGKPIKVVSNRDPLKLPWAELGIDIVIEG 181          
BLAST of CX294957 vs. ExPASy Swiss-Prot
Match: G3PB_PEA (Glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic OS=Pisum sativum GN=GAPB PE=2 SV=2)

HSP 1 Score: 161.77 bits (408), Expect = 2.323e-39
Identity = 79/145 (54.48%), Postives = 109/145 (75.17%), Query Frame = 2
Query:  110 EFSGLRNSASLPFGRKSSDD-FHSVIALQTSALGSSSSGYRKVAAQAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVVAINDTGGVKQASHLLKYDSTLGIFEADVKPVGTDGISVDGKVIQVVSNRNPVNLPWGDWASTL*LKG 541
            EFSGL++++ + +   + D  F+ V+A Q ++  + S+  + V   AKLKVAINGFGRIGRNFLRCWHGRKDSPLEV+ +ND+GGVK ASHLLKYDS LG F+A+VK +  + I+VDGK I+VVS+R+P+ LPW +    + ++G
Sbjct:   39 EFSGLKSTSCISYVHSARDSSFYDVVAAQLTSKANGSTAVKGVTV-AKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSGGVKNASHLLKYDSMLGTFKAEVKILNNETITVDGKPIKVVSSRDPLKLPWAELGIDIVIEG 182          
BLAST of CX294957 vs. ExPASy Swiss-Prot
Match: G3PB_TOBAC (Glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic (Fragment) OS=Nicotiana tabacum GN=GAPB PE=2 SV=1)

HSP 1 Score: 161.384 bits (407), Expect = 3.034e-39
Identity = 84/145 (57.93%), Postives = 106/145 (73.10%), Query Frame = 2
Query:  107 SEFSGLRNSASLPFGRKSSDDFHSVIALQTSALGSSSSGYRKVAAQAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVVAINDTGGVKQASHLLKYDSTLGIFEADVKPVGTDGISVDGKVIQVVSNRNPVNLPWGDWASTL*LKG 541
            +EF+GLR+S  + F  K S  F  V++ Q +   + S+   K    AKLKVAINGFGRIGRNFLRCWHGRKDSPL+VV +ND+GGVK ASHLLKYDS LG F+ADVK V  + ISVDGK I+VVS+R+P+ LPW +    + ++G
Sbjct:    9 AEFAGLRSSGCVTFSNKESS-FFDVVSAQLTPKTTRSTPV-KGETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVVVVNDSGGVKNASHLLKYDSMLGTFKADVKIVDNETISVDGKHIKVVSSRDPLKLPWAELGIDIVIEG 151          
BLAST of CX294957 vs. ExPASy Swiss-Prot
Match: G3PB_ARATH (Glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic OS=Arabidopsis thaliana GN=GAPB PE=1 SV=2)

HSP 1 Score: 157.532 bits (397), Expect = 4.381e-38
Identity = 84/145 (57.93%), Postives = 105/145 (72.41%), Query Frame = 2
Query:  107 SEFSGLRNSASLPFGRKSSDDFHSVIALQTSALGSSSSGYRKVAAQAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVVAINDTGGVKQASHLLKYDSTLGIFEADVKPVGTDGISVDGKVIQVVSNRNPVNLPWGDWASTL*LKG 541
            +EFSGLR S+    G ++S  F   +A Q      ++S   +    AKLKVAINGFGRIGRNFLRCWHGRKDSPLEVV +ND+GGVK ASHLLKYDS LG F+A+VK V  + ISVDGK+I+VVSNR+P+ LPW +    + ++G
Sbjct:   39 AEFSGLRMSS---IGGEAS--FFDAVAAQIIPKAVTTSTPVRGETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVVVLNDSGGVKNASHLLKYDSMLGTFKAEVKIVDNETISVDGKLIKVVSNRDPLKLPWAELGIDIVIEG 178          
BLAST of CX294957 vs. ExPASy Swiss-Prot
Match: G3PA_GRAVE (Glyceraldehyde-3-phosphate dehydrogenase, chloroplastic OS=Gracilaria verrucosa GN=GAPA PE=2 SV=1)

HSP 1 Score: 138.272 bits (347), Expect = 1.053e-34
Identity = 78/162 (48.15%), Postives = 103/162 (63.58%), Query Frame = 2
Query:   47 MASATLSVAKSALQGNGKGFSEFSGLR---NSASLPFGRKSS-----DDFHSVIALQTSALGSSSSGYRKVAAQAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVVAINDTGGVKQASHLLKYDSTLGIFEADVKPVGTDGISVDGKVIQVVSNRNPVNLPW 508
            ++S   + +KSA+      F++FSGL+   N+A L    + S      D +       + +G+ +      A   K++VAINGFGRIGRNF+RCW GR DS ++VV INDT GVK ASHLLKYDS LG F++DV   G D I+VDGK I+VVSNRNP+ LPW
Sbjct:    7 VSSVFSTSSKSAVCSGRSSFAQFSGLKKVNNTARLQTAEQGSAFGGVSDANDAFFNAVNTMGAPARTSN--APSMKVRVAINGFGRIGRNFIRCWAGRTDSNMDVVCINDTSGVKTASHLLKYDSILGTFDSDV-VAGEDSITVDGKTIKVVSNRNPLELPW 165          

HSP 2 Score: 29.261 bits (64), Expect = 1.053e-34
Identity = 13/26 (50.00%), Postives = 17/26 (65.38%), Query Frame = 1
Query:  490 PRQSPLGGLGIDLVIEGTGVFVDREG 567
            P + P   + ID+V+E TGVFVD  G
Sbjct:  160 PLELPWKEMEIDIVVEATGVFVDAVG 185          
The following BLAST results are available for this feature:
BLAST of CX294957 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 114
Match NameE-valueIdentityDescription
G3PA_PEA2.229e-6675.45Glyceraldehyde-3-phosphate dehydrogenase A, chloro... [more]
G3PA_TOBAC8.766e-6375.48Glyceraldehyde-3-phosphate dehydrogenase A, chloro... [more]
G3PA_ARATH2.470e-5770.06Glyceraldehyde-3-phosphate dehydrogenase A, chloro... [more]
G3PA_SPIOL2.731e-5668.48Glyceraldehyde-3-phosphate dehydrogenase A, chloro... [more]
G3PA_MAIZE1.499e-5468.26Glyceraldehyde-3-phosphate dehydrogenase A, chloro... [more]
G3PB_SPIOL9.431e-4157.93Glyceraldehyde-3-phosphate dehydrogenase B, chloro... [more]
G3PB_PEA2.323e-3954.48Glyceraldehyde-3-phosphate dehydrogenase B, chloro... [more]
G3PB_TOBAC3.034e-3957.93Glyceraldehyde-3-phosphate dehydrogenase B, chloro... [more]
G3PB_ARATH4.381e-3857.93Glyceraldehyde-3-phosphate dehydrogenase B, chloro... [more]
G3PA_GRAVE1.053e-3448.15Glyceraldehyde-3-phosphate dehydrogenase, chloropl... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC05065A08SK DroRLeaf1 Citrus clementina cDNA clone C05065A08, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CX294957 ID=CX294957|Name=CX294957|organism=Citrus clementina|type=EST|length=587bp
GAGGCCACTGCTTGCTCTTGCTTGCATCATCCAGCAAATACCTATCATGG
CTTCGGCCACTCTCTCTGTAGCCAAATCAGCTCTTCAGGGAAATGGTAAG
GGATTCTCAGAATTCTCAGGTCTACGCAACTCTGCAAGCCTTCCTTTTGG
CAGGAAATCTTCTGATGACTTCCATTCAGTCATTGCTCTCCAGACCTCTG
CTTTAGGAAGCAGCAGCAGCGGGTACAGGAAGGTTGCTGCTCAGGCAAAG
CTGAAGGTTGCAATCAATGGGTTTGGTAGAATTGGTAGGAACTTCTTGAG
GTGCTGGCACGGCCGCAAGGACTCTCCACTTGAAGTCGTTGCCATCAATG
ACACCGGAGGTGTCAAGCAGGCCTCTCACCTCCTCAAGTACGACTCCACC
CTTGGCATCTTTGAAGCCGATGTTAAACCAGTTGGTACTGATGGCATCTC
TGTTGATGGCAAGGTCATCCAGGTTGTTTCTAACCGCAACCCCGTCAATC
TCCCCTGGGGGGACTGGGCATCGACCTTGTGATTGAAGGGACAGGAGTGT
TTGTAGACAGAGAGGGCGGCAGCACATCAGCTGTGCA
back to top