CX294962

Overview
NameCX294962
Unique NameCX294962
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length769
Libraries
Library NameType
DroRLeaf1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of CX294962 vs. ExPASy Swiss-Prot
Match: FRS5_ARATH (Protein FAR1-RELATED SEQUENCE 5 OS=Arabidopsis thaliana GN=FRS5 PE=2 SV=1)

HSP 1 Score: 128.257 bits (321), Expect = 4.718e-29
Identity = 67/209 (32.06%), Postives = 111/209 (53.11%), Query Frame = 3
Query:   60 QYELRANPWLKTQYMLRRKWAYCFCKSVFSAGIRSTQHCHGISHIFHSLTSKATTPLQFVQQYFKVAEQQRREELYEDLRCNGSAPPTILRSNAIEKEAAKIYSCTMFKLFQEELLECLSVAIEEIQGDGMTAKFRLTEEGQK-KEKIVEFNCMETHLTCSCKKYESVGILCVHALKVLNAKNIFHIPPQYILKRWTKSAKDGMVVNGH 683
            +YELR + WL+  Y  RR+W   + +  F A +  T     I+  F    + +T   QF + Y K  E +  +E+  D     S PP +   + +EK+A+++Y+  +F  FQEEL+  L+    +   DG    +++ + G+  K   V+FN +E    CSC+ +E  GI+C H L V    N+  +PP YILKRWT++AK  ++ + +
Sbjct:  435 KYELRDHEWLQAIYSDRRQWVPVYLRDTFFADMSLTHRSDSINSYFDGYINASTNLSQFFKLYEKALESRLEKEVKADYDTMNS-PPVLKTPSPMEKQASELYTRKLFMRFQEELVGTLTFMASKADDDGDLVTYQVAKYGEAHKAHFVKFNVLEMRANCSCQMFEFSGIICRHILAVFRVTNLLTLPPYYILKRWTRNAKSSVIFDDY 642          
BLAST of CX294962 vs. ExPASy Swiss-Prot
Match: FRS9_ARATH (Protein FAR1-RELATED SEQUENCE 9 OS=Arabidopsis thaliana GN=FRS9 PE=2 SV=1)

HSP 1 Score: 122.865 bits (307), Expect = 1.982e-27
Identity = 63/201 (31.34%), Postives = 104/201 (51.74%), Query Frame = 3
Query:   60 QYELRANPWLKTQYMLRRKWAYCFCKSVFSAGIRSTQHCHGISHIFHSLTSKATTPLQFVQQYFKVAEQQRREELYEDLRCNGSAPPTILRSNAIEKEAAKIYSCTMFKLFQEELLECLSVAIEEIQGDGMTAKFRLTEEGQ-KKEKIVEFNCMETHLTCSCKKYESVGILCVHALKVLNAKNIFHIPPQYILKRWTKSAK 659
            +Y +  N WL++ Y  R++W   F +  F   + + +    ++  F      +TT    ++QY K  +  R +EL  D     S P  +   + +EK+AA +Y+   F  FQEE +E L++    I   G    +R+ + G+  K   V F+ +E    CSC+ +E  GI+C H L V +AKN+  +P +Y+L+RWTK AK
Sbjct:  186 RYYMEDNDWLQSIYNARQQWVRVFIRDTFYGELSTNEGSSILNSFFQGFVDASTTMQMLIKQYEKAIDSWREKELKADYEATNSTP-VMKTPSPMEKQAASLYTRAAFIKFQEEFVETLAIPANIISDSGTHTTYRVAKFGEVHKGHTVSFDSLEVKANCSCQMFEYSGIICRHILAVFSAKNVLALPSRYLLRRWTKEAK 385          
BLAST of CX294962 vs. ExPASy Swiss-Prot
Match: FRS3_ARATH (Protein FAR1-RELATED SEQUENCE 3 OS=Arabidopsis thaliana GN=FRS3 PE=2 SV=2)

HSP 1 Score: 121.709 bits (304), Expect = 4.416e-27
Identity = 74/229 (32.31%), Postives = 114/229 (49.78%), Query Frame = 3
Query:   60 QYELRANPWLKTQYMLRRKWAYCFCKSVFSAGIRSTQHCHGISHIFHSLTSKATTPLQFVQQYFKVAEQQRREELYEDLRCNGSAPPTILRSNAIEKEAAKIYSCTMFKLFQEELLECLSVAIEEIQGDGMTAKFRLTE-EGQKKEKIVEFNCMETHLTCSCKKYESVGILCVHALKVLNAKNIFHIPPQYILKRWTKSAKDGMVVNGHEGEVVDDSQKHLHLDESNLC 743
            +Y+L  + WL + Y  R +W   + +  F A +  +Q   G    F    ++ TT   F + Y +  E     E+  DL    + PP +   + +E +AA +++  +F  FQEEL+E  +     I+ DG T+ FR+   E   K  IV F   E    CSC+ +E  GILC H L V    NI  +PP YIL+RWT++AK  + ++ H  E   DS  H +   ++LC
Sbjct:  382 KYDLGRHEWLNSLYNARAQWVPVYFRDSFFAAVFPSQGYSG--SFFDGYVNQQTTLPMFFRLYERAMESWFEMEIEADLD-TVNTPPVLKTPSPMENQAANLFTRKIFGKFQEELVETFAHTANRIEDDGTTSTFRVANFENDNKAYIVTFCYPEMRANCSCQMFEHSGILCRHVLTVFTVTNILTLPPHYILRRWTRNAKSMVELDEHVSENGHDSSIHRY---NHLC 604          
BLAST of CX294962 vs. ExPASy Swiss-Prot
Match: FRS12_ARATH (Protein FAR1-RELATED SEQUENCE 12 OS=Arabidopsis thaliana GN=FRS12 PE=2 SV=1)

HSP 1 Score: 119.398 bits (298), Expect = 2.192e-26
Identity = 69/217 (31.80%), Postives = 116/217 (53.46%), Query Frame = 3
Query:   60 QYELRANPWLKTQYMLRRKWAYCFCKSVFSAGIRSTQHCHGISHIFHSLTSKATTPL-QFVQQYFKVAEQQRREELYEDLRCNGSAPPTILRSNAIEKEAAKIYSCTMFKLFQEELLECLSVAIEEIQGDGMTAKFRLTEEGQKKEK-IVEFNCMETHLTCSCKKYESVGILCVHALKVLNAKNIFHIPPQYILKRWTKSAKDGMVVNGHEGEVVDD 704
            +Y LR + WL+  Y  R  W   + ++ F AGI      +G    F   +  A TPL +F+ +Y +  EQ+R EE  ED   + +  P +     +E++  ++Y+ T+F++FQ EL++  +    +   +G  ++F + + G + EK  V F+    + +CSC+ +E  G+LC H LKV N  +I  +P +YIL RWTK+A+ G V +   G    D
Sbjct:  532 KYGLRDDVWLREIYEQRENWVPAYLRASFFAGIP----INGTIEPFFGASLDALTPLREFISRYEQALEQRREEERKEDFN-SYNLQPFLQTKEPVEEQCRRLYTLTVFRIFQNELVQSYNYLCLKTYEEGAISRFLVRKCGNESEKHAVTFSASNLNSSCSCQMFEHEGLLCRHILKVFNLLDIRELPSRYILHRWTKNAEFGFVRDMESGVSAQD 743          
BLAST of CX294962 vs. ExPASy Swiss-Prot
Match: FRS7_ARATH (Protein FAR1-RELATED SEQUENCE 7 OS=Arabidopsis thaliana GN=FRS7 PE=2 SV=1)

HSP 1 Score: 118.627 bits (296), Expect = 3.738e-26
Identity = 69/217 (31.80%), Postives = 115/217 (53.00%), Query Frame = 3
Query:   60 QYELRANPWLKTQYMLRRKWAYCFCKSVFSAGIRSTQHCHGISHIFHSLTSKATTPL-QFVQQYFKVAEQQRREELYEDLRCNGSAPPTILRSNAIEKEAAKIYSCTMFKLFQEELLECLSVAIEEIQGDGMTAKFRLTEEGQKKEK-IVEFNCMETHLTCSCKKYESVGILCVHALKVLNAKNIFHIPPQYILKRWTKSAKDGMVVNGHEGEVVDD 704
            +Y LR N WL+  Y  R KW   + ++ F  GI    H  G    F+  +  + T L +F+ +Y +  EQ+R EE  ED   + +  P +     +E++  ++Y+ T+F++FQ EL +  +    +   +G  ++F + + G + EK  V F+    + +CSC+ +E  G+LC H LKV N  +I  +P +YIL RWTK+A+ G V +   G    D
Sbjct:  508 KYGLRDNMWLREIYEKREKWVPAYLRASFFGGI----HVDGTFDPFYGTSLNSLTSLREFISRYEQGLEQRREEERKEDFN-SYNLQPFLQTKEPVEEQCRRLYTLTIFRIFQSELAQSYNYLGLKTYEEGAISRFLVRKCGNENEKHAVTFSASNLNASCSCQMFEYEGLLCRHILKVFNLLDIRELPSRYILHRWTKNAEFGFVRDVESGVTSQD 719          
BLAST of CX294962 vs. ExPASy Swiss-Prot
Match: FAR1_ARATH (Protein FAR-RED IMPAIRED RESPONSE 1 OS=Arabidopsis thaliana GN=FAR1 PE=1 SV=1)

HSP 1 Score: 114.005 bits (284), Expect = 9.207e-25
Identity = 70/218 (32.11%), Postives = 110/218 (50.46%), Query Frame = 3
Query:   60 QYELRANPWLKTQYMLRRKWAYCFCKSVFSAGIRSTQHCHGISHIFHSLTSKATTPLQFVQQYFKVAEQQRREELYEDL-RCNGSAPPTILRSNAIEKEAAKIYSCTMFKLFQEELLECLSVAIEEIQGDGMTAKFRLTEEGQKKEKIVEFNCMETHLTCSCKKYESVGILCVHALKVLNAKNIFHIPPQYILKRWTKSAKDGMVVNGHEGEVVDDSQ 710
            Q+ L  + WL   +  R+KW   F   VF AG+ ++Q    ++  F     K  T  +F++QY  + + +  EE   D   C+    P +   +  EK+ A  Y+ T+FK FQ E+L  ++    + + D   A FR+ +  +  + +V ++  ++ L C C+ +E  G LC HAL +L       IPPQYILKRWTK AK G++     GE  D  Q
Sbjct:  411 QFGLENDEWLLWLHEHRQKWVPTFMSDVFLAGMSTSQRSESVNSFFDKYIHKKITLKEFLRQYGVILQNRYEEESVADFDTCHKQ--PALKSPSPWEKQMATTYTHTIFKKFQVEVLGVVACHPRKEKEDENMATFRVQDCEKDDDFLVTWSKTKSELCCFCRMFEYKGFLCRHALMILQMCGFASIPPQYILKRWTKDAKSGVLA----GEGADQIQ 622          
BLAST of CX294962 vs. ExPASy Swiss-Prot
Match: FHY3_ARATH (Protein FAR-RED ELONGATED HYPOCOTYL 3 OS=Arabidopsis thaliana GN=FHY3 PE=1 SV=1)

HSP 1 Score: 110.153 bits (274), Expect = 1.330e-23
Identity = 61/200 (30.50%), Postives = 104/200 (52.00%), Query Frame = 3
Query:   60 QYELRANPWLKTQYMLRRKWAYCFCKSVFSAGIRSTQHCHGISHIFHSLTSKATTPLQFVQQYFKVAEQQRREELYEDLRCNGSAPPTILRSNAIEKEAAKIYSCTMFKLFQEELLECLSVAIEEIQGDGMTAKFRLTEEGQKKEKIVEFNCMETHLTCSCKKYESVGILCVHALKVLNAKNIFHIPPQYILKRWTKSAK 659
            ++ L+ + W+ + Y  R+KWA  +   V  AG+ ++Q    I+  F     K T+  +FV+ Y  V + +  EE   D     +  P +   +  EK  +++Y+  +FK FQ E+L  ++ +  E   D   + FR+ +    ++ +V +N  +  ++C C+ +E  G LC H L VL   ++  IP QYILKRWTK AK
Sbjct:  420 RFGLKDDQWMISLYEDRKKWAPTYMTDVLLAGMSTSQRADSINAFFDKYMHKKTSVQEFVKVYDTVLQDRCEEEAKADSEM-WNKQPAMKSPSPFEKSVSEVYTPAVFKKFQIEVLGAIACSPREENRDATCSTFRVQDFENNQDFMVTWNQTKAEVSCICRLFEYKGYLCRHTLNVLQCCHLSSIPSQYILKRWTKDAK 618          
BLAST of CX294962 vs. ExPASy Swiss-Prot
Match: FRS2_ARATH (Protein FAR1-RELATED SEQUENCE 2 OS=Arabidopsis thaliana GN=FRS2 PE=2 SV=1)

HSP 1 Score: 107.071 bits (266), Expect = 1.126e-22
Identity = 61/201 (30.35%), Postives = 100/201 (49.75%), Query Frame = 3
Query:   60 QYELRANPWLKTQYMLRRKWAYCFCKSVFSAGIRSTQHCHGISHIFHSLTSKATTPLQFVQQYFKVAEQQRREELYEDLRCNGSAPPTILRSNAIEKEAAKIYSCTMFKLFQEELLECLSVAIEEIQGDGMTAKFRLTEEGQKKEKIVEFNCMETHLTCSCKKYESVGILCVHALKVLNAKNIFHIPPQYILKRWTKSAKD 662
            ++EL  N W++  +  R+KW   +   +  AG+   +    I+  F    +   T   F + Y K  + +   E  +DL    S  PT+  S A EK+ + IY+   FK FQ E+   +S  +++ + DG TA FR+ +  +++   V  N       CSC  +E  G LC HA+ VL + ++  +P QYILKRW+K   +
Sbjct:  355 KFELNENEWVQLLFRDRKKWVPHYFHGICLAGLSGPERSGSIASHFDKYMNSEATFKDFFELYMKFLQYRCDVEAKDDLEYQ-SKQPTLRSSLAFEKQLSLIYTDAAFKKFQAEVPGVVSCQLQKEREDGTTAIFRIEDFEERQNFFVALNNELLDACCSCHLFEYQGFLCKHAILVLQSADVSRVPSQYILKRWSKKGNN 554          
BLAST of CX294962 vs. ExPASy Swiss-Prot
Match: FRS1_ARATH (Protein FAR1-RELATED SEQUENCE 1 OS=Arabidopsis thaliana GN=FRS1 PE=1 SV=1)

HSP 1 Score: 107.071 bits (266), Expect = 1.126e-22
Identity = 64/214 (29.91%), Postives = 110/214 (51.40%), Query Frame = 3
Query:   60 QYELRANPWLKTQYMLRRKWAYCFCKSVFSAGIRSTQHCHGISHIFHSLTSKATTPLQFVQQYFKVAEQQRREELYEDLRCNGSAPPTILRSNAIEKEAAKIYSCTMFKLFQEELLECLSV-AIEEIQGDGMTAK-FRLTEEGQKKEKIVEFNCMETHLTCSCKKYESVGILCVHALKVLNAKNIFHIPPQYILKRWTKSAKDGMVVNGHEGEV 695
            ++ +R N WL++ Y  R  W   + K V  AG+ + Q    ++        + TT   F++QY K+ +++  EE   ++      P  +   +   K+ A++Y+  MFK FQ E+L  ++    +E + DG+  + FR+ +  Q +  +V +N   + + CSC+ +E  G LC HA+ VL       IP QY+LKRWTK AK   V+   + +V
Sbjct:  294 RFHMRDNVWLQSLYEDREYWVPVYMKDVSLAGMCTAQRSDSVNSGLDKYIQRKTTFKAFLEQYKKMIQERYEEEEKSEIETLYKQPG-LKSPSPFGKQMAEVYTREMFKKFQVEVLGGVACHPKKESEEDGVNKRTFRVQDYEQNRSFVVVWNSESSEVVCSCRLFELKGFLCRHAMIVLQMSGELSIPSQYVLKRWTKDAKSREVMESDQTDV 506          
BLAST of CX294962 vs. ExPASy Swiss-Prot
Match: FRS4_ARATH (Protein FAR1-RELATED SEQUENCE 4 OS=Arabidopsis thaliana GN=FRS4 PE=2 SV=1)

HSP 1 Score: 98.2117 bits (243), Expect = 5.228e-20
Identity = 55/201 (27.36%), Postives = 103/201 (51.24%), Query Frame = 3
Query:   60 QYELRANPWLKTQYMLRRKWAYCFCKSVFSAGIRSTQHCHGISHIFHSLTSKATTPLQFVQQYFKVAEQQRREELYEDLRCNGSAPPTILRSNAIEKEAAKIYSCTMFKLFQEELLECLSVAIEEIQGDGMTAKFRLTEEGQKKEKIVEFNCMETHLTCSCKKYESVGILCVHALKVLNAKNIFHIPPQYILKRWTKSAKD 662
            ++ LR  PW+++ Y  R+ WA  F + +  AG+        ++ +F       T+  +F++ Y  + E +  EE   D      AP  +   +  EK+   +YS  +F+ FQ E+L   +  + +   +G T   +  ++ QK   +V+++  ++ + CSC+ +E  G LC HA+ VL    +F IP  Y+L+RWT +A++
Sbjct:  348 KFHLRDVPWMRSLYEERKFWAPTFMRGITFAGLSMRCRSESVNSLFDRYVHPETSLKEFLEGYGLMLEDRYEEEAKADFDAWHEAPE-LKSPSPFEKQMLLVYSHEIFRRFQLEVLGAAACHLTKESEEGTTYSVKDFDDEQKY--LVDWDEFKSDIYCSCRSFEYKGYLCRHAIVVLQMSGVFTIPINYVLQRWTNAARN 545          
The following BLAST results are available for this feature:
BLAST of CX294962 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 13
Match NameE-valueIdentityDescription
FRS5_ARATH4.718e-2932.06Protein FAR1-RELATED SEQUENCE 5 OS=Arabidopsis tha... [more]
FRS9_ARATH1.982e-2731.34Protein FAR1-RELATED SEQUENCE 9 OS=Arabidopsis tha... [more]
FRS3_ARATH4.416e-2732.31Protein FAR1-RELATED SEQUENCE 3 OS=Arabidopsis tha... [more]
FRS12_ARATH2.192e-2631.80Protein FAR1-RELATED SEQUENCE 12 OS=Arabidopsis th... [more]
FRS7_ARATH3.738e-2631.80Protein FAR1-RELATED SEQUENCE 7 OS=Arabidopsis tha... [more]
FAR1_ARATH9.207e-2532.11Protein FAR-RED IMPAIRED RESPONSE 1 OS=Arabidopsis... [more]
FHY3_ARATH1.330e-2330.50Protein FAR-RED ELONGATED HYPOCOTYL 3 OS=Arabidops... [more]
FRS2_ARATH1.126e-2230.35Protein FAR1-RELATED SEQUENCE 2 OS=Arabidopsis tha... [more]
FRS1_ARATH1.126e-2229.91Protein FAR1-RELATED SEQUENCE 1 OS=Arabidopsis tha... [more]
FRS4_ARATH5.228e-2027.36Protein FAR1-RELATED SEQUENCE 4 OS=Arabidopsis tha... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC05065B01SK DroRLeaf1 Citrus clementina cDNA clone C05065B01, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CX294962 ID=CX294962|Name=CX294962|organism=Citrus clementina|type=EST|length=769bp
GATTGGCCGAGGGTGAATCAGAGGAAGAATTCGAGTCTATGTGGGAATAT
TTACTGGAGCAATATGAGCTTCGTGCAAATCCTTGGCTCAAAACTCAATA
TATGTTGAGAAGAAAATGGGCTTATTGTTTCTGTAAGAGTGTCTTCTCTG
CTGGCATACGATCAACCCAACACTGTCACGGCATCAGTCATATTTTCCAC
AGTTTGACAAGCAAGGCAACAACTCCATTGCAGTTTGTTCAGCAGTACTT
TAAAGTGGCAGAGCAACAGCGTAGAGAAGAATTATATGAAGATCTTCGCT
GCAATGGAAGTGCACCTCCAACAATTTTAAGAAGCAATGCAATTGAGAAA
GAAGCAGCAAAGATATATAGCTGCACAATGTTTAAGCTTTTCCAAGAAGA
GTTGCTTGAATGTTTGTCAGTGGCAATAGAAGAAATTCAAGGTGATGGAA
TGACTGCTAAATTCAGGCTAACTGAGGAAGGCCAGAAGAAGGAGAAAATT
GTTGAATTTAATTGTATGGAAACCCATCTCACATGTAGTTGCAAAAAATA
TGAGTCGGTTGGCATCTTATGTGTACATGCCTTGAAAGTACTGAATGCTA
AAAATATCTTTCATATACCTCCTCAGTATATATTGAAGAGGTGGACAAAA
TCAGCAAAAGATGGGATGGTGGTAAATGGCCACGAAGGGGAAGTTGTTGA
TGACAGCCAGAAGCATTTGCATCTGGATGAGAGTAACTTATGCACAAGCT
TTAATGTCATACTAAAGCT
back to top