CX294963

Overview
NameCX294963
Unique NameCX294963
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length523
Libraries
Library NameType
DroRLeaf1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig602 contig Ccv1_Contig602:1..523. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CX294963 vs. ExPASy Swiss-Prot
Match: SPD1_ARATH (Spermidine synthase 1 OS=Arabidopsis thaliana GN=SPDSYN1 PE=1 SV=1)

HSP 1 Score: 159.458 bits (402), Expect = 8.856e-39
Identity = 78/156 (50.00%), Postives = 102/156 (65.38%), Query Frame = 3
Query:   54 KESNKNGSAGAIPSCCLKARASAPELDAKCHSTVVSGWFSESQSTSDKTGKTMYFNNPMWPGEAHSLKVKEILFKGKSEYQEVLVFESLAYGKVLVLDGIVQLTEKDECAYQEMIAHLPLCSIPSPKTXXXXXXXXXXXXREISRHDSVELIDICE 521
            +E + NG A       ++      + +  C STV+ GWFSE               +PMWPGEAHSLKV+++LF+GKS+YQ+V+VF+S  YGKVLVLDG++QLTE+DECAYQEMI HLPLCSIP+PK             RE++RH S+E ID+CE
Sbjct:   15 REEDDNGGAAT-----METENGDQKKEPACFSTVIPGWFSEM--------------SPMWPGEAHSLKVEKVLFQGKSDYQDVIVFQSATYGKVLVLDGVIQLTERDECAYQEMITHLPLCSIPNPKKVLVIGGGDGGVLREVARHASIEQIDMCE 151          
BLAST of CX294963 vs. ExPASy Swiss-Prot
Match: SPD2_DATST (Spermidine synthase 2 OS=Datura stramonium PE=2 SV=1)

HSP 1 Score: 157.918 bits (398), Expect = 2.577e-38
Identity = 76/130 (58.46%), Postives = 94/130 (72.31%), Query Frame = 3
Query:  132 DAKCHSTVVSGWFSESQSTSDKTGKTMYFNNPMWPGEAHSLKVKEILFKGKSEYQEVLVFESLAYGKVLVLDGIVQLTEKDECAYQEMIAHLPLCSIPSPKTXXXXXXXXXXXXREISRHDSVELIDICE 521
            ++ C S+V+ GWFSE               +P+WPGEAHSLKV++ILF+GKS+YQ+V+VF+S  YGKVLVLDG++QLTE+DECAYQEMI HLPLCSIP+PK             RE+SRH SVE IDICE
Sbjct:   18 ESPCISSVLPGWFSEI--------------SPLWPGEAHSLKVEKILFQGKSDYQDVMVFQSTTYGKVLVLDGVIQLTERDECAYQEMITHLPLCSIPNPKKVLVIGGGDGGVLREVSRHSSVEQIDICE 133          
BLAST of CX294963 vs. ExPASy Swiss-Prot
Match: SPDE_COFAR (Spermidine synthase OS=Coffea arabica PE=2 SV=1)

HSP 1 Score: 155.606 bits (392), Expect = 1.279e-37
Identity = 77/125 (61.60%), Postives = 91/125 (72.80%), Query Frame = 3
Query:  147 STVVSGWFSESQSTSDKTGKTMYFNNPMWPGEAHSLKVKEILFKGKSEYQEVLVFESLAYGKVLVLDGIVQLTEKDECAYQEMIAHLPLCSIPSPKTXXXXXXXXXXXXREISRHDSVELIDICE 521
            S+V+ GWFSE               +PMWPGEAHSLKV++ILF+GKS+YQ V+VF+S  YGKVLVLDG++QLTE+DECAYQEMIAHLPLCSIPSPK             RE++RH SVE IDICE
Sbjct:   21 SSVIPGWFSEI--------------SPMWPGEAHSLKVEKILFQGKSDYQNVMVFQSSTYGKVLVLDGVIQLTERDECAYQEMIAHLPLCSIPSPKKVLVIGGGDGGVLREVARHLSVEQIDICE 131          
BLAST of CX294963 vs. ExPASy Swiss-Prot
Match: SPDE_NICSY (Spermidine synthase OS=Nicotiana sylvestris PE=2 SV=1)

HSP 1 Score: 155.221 bits (391), Expect = 1.670e-37
Identity = 76/125 (60.80%), Postives = 91/125 (72.80%), Query Frame = 3
Query:  147 STVVSGWFSESQSTSDKTGKTMYFNNPMWPGEAHSLKVKEILFKGKSEYQEVLVFESLAYGKVLVLDGIVQLTEKDECAYQEMIAHLPLCSIPSPKTXXXXXXXXXXXXREISRHDSVELIDICE 521
            S+V+ GWFSE               +P+WPGEAHSLKV++ILF+GKS+YQ V+VF+S  YGKVLVLDG++QLTE+DECAYQEMIAHLPLCSIP+PK             RE+SRH SVE IDICE
Sbjct:   19 SSVLPGWFSEI--------------SPLWPGEAHSLKVEKILFQGKSDYQNVMVFQSSTYGKVLVLDGVIQLTERDECAYQEMIAHLPLCSIPNPKKVLVIGGGDGGVLREVSRHSSVEQIDICE 129          
BLAST of CX294963 vs. ExPASy Swiss-Prot
Match: SPD2_PEA (Spermidine synthase 2 OS=Pisum sativum GN=SPDSYN2 PE=2 SV=1)

HSP 1 Score: 155.221 bits (391), Expect = 1.670e-37
Identity = 74/125 (59.20%), Postives = 91/125 (72.80%), Query Frame = 3
Query:  147 STVVSGWFSESQSTSDKTGKTMYFNNPMWPGEAHSLKVKEILFKGKSEYQEVLVFESLAYGKVLVLDGIVQLTEKDECAYQEMIAHLPLCSIPSPKTXXXXXXXXXXXXREISRHDSVELIDICE 521
            S+V+ GWFSE               +PMWPGEAHSLK+++ILF+GKSEYQ+V+VF+S  YGKVLVLDG++QLTE+DECAYQEMI HLPLCSIP+PK             RE++RH S+E IDICE
Sbjct:   48 SSVIPGWFSEI--------------SPMWPGEAHSLKIEKILFQGKSEYQKVMVFQSSTYGKVLVLDGVIQLTERDECAYQEMITHLPLCSIPNPKKVLVIGGGDGGVLREVARHSSIEKIDICE 158          
BLAST of CX294963 vs. ExPASy Swiss-Prot
Match: SPD2_ARATH (Spermidine synthase 2 OS=Arabidopsis thaliana GN=SPDSYN2 PE=1 SV=2)

HSP 1 Score: 155.221 bits (391), Expect = 1.670e-37
Identity = 74/130 (56.92%), Postives = 92/130 (70.77%), Query Frame = 3
Query:  132 DAKCHSTVVSGWFSESQSTSDKTGKTMYFNNPMWPGEAHSLKVKEILFKGKSEYQEVLVFESLAYGKVLVLDGIVQLTEKDECAYQEMIAHLPLCSIPSPKTXXXXXXXXXXXXREISRHDSVELIDICE 521
            +  C S+++ GWFSE               +PMWPGEAHSLKV++ILF+GKS+YQ+V+VF+S  YGKVLVLDG++QLTE+DECAYQEMI HLPLCSI +PK             RE++RH SVE IDICE
Sbjct:   40 EPSCMSSIIPGWFSEI--------------SPMWPGEAHSLKVEKILFQGKSDYQDVIVFQSATYGKVLVLDGVIQLTERDECAYQEMITHLPLCSISNPKKVLVIGGGDGGVLREVARHSSVEQIDICE 155          
BLAST of CX294963 vs. ExPASy Swiss-Prot
Match: SPD1_PEA (Spermidine synthase 1 OS=Pisum sativum GN=SPDSYN1 PE=2 SV=1)

HSP 1 Score: 155.221 bits (391), Expect = 1.670e-37
Identity = 74/125 (59.20%), Postives = 91/125 (72.80%), Query Frame = 3
Query:  147 STVVSGWFSESQSTSDKTGKTMYFNNPMWPGEAHSLKVKEILFKGKSEYQEVLVFESLAYGKVLVLDGIVQLTEKDECAYQEMIAHLPLCSIPSPKTXXXXXXXXXXXXREISRHDSVELIDICE 521
            S+V+ GWFSE               +PMWPGEAHSLKV++ILF+GKS+YQ+V+VF+S  YGKVL+LDG++QLTE+DECAYQEMI HLPLCSIP+PK             RE++RH SVE IDICE
Sbjct:   40 SSVIPGWFSEI--------------SPMWPGEAHSLKVEKILFQGKSDYQDVMVFQSATYGKVLILDGVIQLTERDECAYQEMITHLPLCSIPNPKKVLVIGGGDGGVLREVARHSSVEKIDICE 150          
BLAST of CX294963 vs. ExPASy Swiss-Prot
Match: SPDE_SOLLC (Spermidine synthase OS=Solanum lycopersicum GN=SPDSYN PE=2 SV=1)

HSP 1 Score: 154.451 bits (389), Expect = 2.849e-37
Identity = 76/125 (60.80%), Postives = 90/125 (72.00%), Query Frame = 3
Query:  147 STVVSGWFSESQSTSDKTGKTMYFNNPMWPGEAHSLKVKEILFKGKSEYQEVLVFESLAYGKVLVLDGIVQLTEKDECAYQEMIAHLPLCSIPSPKTXXXXXXXXXXXXREISRHDSVELIDICE 521
            S+V+ GWFSE               +P+WPGEAHSLKV++ILF+GKS+YQ VLVF+S  YGKVLVLDG++QLTE+DECAYQEMI HLPLCSIP+PK             RE+SRH SVE IDICE
Sbjct:   48 SSVLPGWFSEI--------------SPLWPGEAHSLKVEKILFQGKSDYQNVLVFQSSTYGKVLVLDGVIQLTERDECAYQEMITHLPLCSIPNPKKVLVIGGGDGGVLREVSRHSSVEQIDICE 158          
BLAST of CX294963 vs. ExPASy Swiss-Prot
Match: SPD1_HYONI (Spermidine synthase 1 OS=Hyoscyamus niger PE=2 SV=1)

HSP 1 Score: 153.68 bits (387), Expect = 4.860e-37
Identity = 75/125 (60.00%), Postives = 90/125 (72.00%), Query Frame = 3
Query:  147 STVVSGWFSESQSTSDKTGKTMYFNNPMWPGEAHSLKVKEILFKGKSEYQEVLVFESLAYGKVLVLDGIVQLTEKDECAYQEMIAHLPLCSIPSPKTXXXXXXXXXXXXREISRHDSVELIDICE 521
            S+V+ GWFSE               +P+WPGEAHSLKV++ILF+GKS+YQ V+VF+S  YGKVLVLDG++QLTE+DECAYQEMI HLPLCSIP+PK             RE+SRH SVE IDICE
Sbjct:   21 SSVLPGWFSEI--------------SPLWPGEAHSLKVEKILFQGKSDYQNVMVFQSSTYGKVLVLDGVIQLTERDECAYQEMITHLPLCSIPNPKKVLVIGGGDGGVLREVSRHSSVEQIDICE 131          
BLAST of CX294963 vs. ExPASy Swiss-Prot
Match: SPD2_HYONI (Spermidine synthase 2 OS=Hyoscyamus niger PE=2 SV=1)

HSP 1 Score: 152.91 bits (385), Expect = 8.289e-37
Identity = 74/125 (59.20%), Postives = 90/125 (72.00%), Query Frame = 3
Query:  147 STVVSGWFSESQSTSDKTGKTMYFNNPMWPGEAHSLKVKEILFKGKSEYQEVLVFESLAYGKVLVLDGIVQLTEKDECAYQEMIAHLPLCSIPSPKTXXXXXXXXXXXXREISRHDSVELIDICE 521
            S+++ GWFSE               +P+WPGEAHSLKV++ILF+GKS+YQ V+VF+S  YGKVLVLDG++QLTE+DECAYQEMI HLPLCSIP+PK             RE+SRH SVE IDICE
Sbjct:   13 SSILPGWFSEI--------------SPLWPGEAHSLKVEKILFQGKSDYQNVVVFQSSTYGKVLVLDGVIQLTERDECAYQEMITHLPLCSIPNPKKVLVIGGGDGGVLREVSRHSSVEQIDICE 123          
The following BLAST results are available for this feature:
BLAST of CX294963 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 127
Match NameE-valueIdentityDescription
SPD1_ARATH8.856e-3950.00Spermidine synthase 1 OS=Arabidopsis thaliana GN=S... [more]
SPD2_DATST2.577e-3858.46Spermidine synthase 2 OS=Datura stramonium PE=2 SV... [more]
SPDE_COFAR1.279e-3761.60Spermidine synthase OS=Coffea arabica PE=2 SV=1[more]
SPDE_NICSY1.670e-3760.80Spermidine synthase OS=Nicotiana sylvestris PE=2 S... [more]
SPD2_PEA1.670e-3759.20Spermidine synthase 2 OS=Pisum sativum GN=SPDSYN2 ... [more]
SPD2_ARATH1.670e-3756.92Spermidine synthase 2 OS=Arabidopsis thaliana GN=S... [more]
SPD1_PEA1.670e-3759.20Spermidine synthase 1 OS=Pisum sativum GN=SPDSYN1 ... [more]
SPDE_SOLLC2.849e-3760.80Spermidine synthase OS=Solanum lycopersicum GN=SPD... [more]
SPD1_HYONI4.860e-3760.00Spermidine synthase 1 OS=Hyoscyamus niger PE=2 SV=... [more]
SPD2_HYONI8.289e-3759.20Spermidine synthase 2 OS=Hyoscyamus niger PE=2 SV=... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC05065B02SK DroRLeaf1 Citrus clementina cDNA clone C05065B02, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CX294963 ID=CX294963|Name=CX294963|organism=Citrus clementina|type=EST|length=523bp
ATATGGAGGGCGGCGAAGGAAAAGGTTTGGGATGCCAGAAGACTATGGAT
GGGAAGGAGAGTAACAAGAATGGTTCAGCGGGGGCAATCCCTTCTTGTTG
CTTGAAAGCAAGGGCTTCAGCCCCAGAGCTTGATGCCAAATGCCACTCCA
CTGTTGTTTCTGGGTGGTTTTCAGAATCTCAGTCTACCTCTGATAAAACT
GGCAAAACAATGTACTTCAACAATCCAATGTGGCCAGGAGAGGCCCATTC
ATTGAAAGTAAAAGAAATTTTATTCAAGGGAAAGTCTGAGTACCAAGAGG
TCCTGGTTTTTGAGTCATTGGCATATGGGAAAGTGCTTGTTCTTGATGGA
ATTGTTCAACTAACGGAGAAAGATGAATGTGCTTACCAGGAGATGATAGC
TCATCTTCCCCTTTGTTCGATTCCATCTCCGAAAACCGTTCTAGTTGTTG
GTGGTGGTGATGGTGGTGTTCTTAGGGAGATTTCTCGTCACGACTCTGTT
GAGCTTATTGATATATGTGAGAT
back to top