CX295127

Overview
NameCX295127
Unique NameCX295127
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length552
Libraries
Library NameType
DroRLeaf1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of CX295127 vs. ExPASy Swiss-Prot
Match: MIRA_RICDU (Miraculin OS=Richadella dulcifica PE=1 SV=3)

HSP 1 Score: 97.4413 bits (241), Expect = 4.695e-20
Identity = 64/172 (37.21%), Postives = 93/172 (54.07%), Query Frame = 3
Query:   75 PLLGISSNS-EPVLDIIGNKVKSTLEYKLIPVLDGAGGFSTHLGT--NGQ--CPLDVIQLSSPSERGDNLRLLPYDNYK--IVKVSTDVNLRFPVKVSVKPCN--EEPLWKVDSYDDP----LIVTGGSEGHPGAETLLNWFKIEKAGNFSYGGVYNIVHCPSVCLSCPRRC 551
            PLL  + ++  PVLDI G K+++   Y ++PVL   GG  T   T  NG   CP  V+Q     +    L   P +N K  +V+VSTD+N+ F    +  PC      +W++D YD+      +  GG +G+PG ET+ +WFKIE+   F   G Y +V CP+VC SC  +C
Sbjct:   24 PLLSAADSAPNPVLDIDGEKLRTGTNYYIVPVLRDHGGGLTVSATTPNGTFVCPPRVVQTRKEVDHDRPLAFFP-ENPKEDVVRVSTDLNINFS---AFMPCRWTSSTVWRLDKYDESTGQYFVTIGGVKGNPGPETISSWFKIEE---FCGSGFYKLVFCPTVCGSCKVKC 188          
BLAST of CX295127 vs. ExPASy Swiss-Prot
Match: ASP_THECC (21 kDa seed protein OS=Theobroma cacao GN=ASP PE=2 SV=1)

HSP 1 Score: 97.4413 bits (241), Expect = 4.695e-20
Identity = 58/158 (36.71%), Postives = 87/158 (55.06%), Query Frame = 3
Query:   99 SEPVLDIIGNKVKSTLEYKLIPVLDGAGGFSTHLG--TNGQCPLDVIQLSSPSERGDNLRLLPYDNYK-IVKVSTDVNLRFPVKVSVKPCNEEPLWKVDSYDDPL----IVTGGSEGHPGAETLLNWFKIEKAGNFSYGGVYNIVHCPSVCLSCPRRC 551
            + PVLD  G+++++ ++Y ++  + GAGG    LG  T   CP  V+Q  S  + G  +     D+   +V+VSTDVN+ F V +  + C+   +W++D+YD+      + T G +G PG  TL +WFKIEKAG       Y    CPSVC SC   C
Sbjct:   28 NSPVLDTDGDELQTGVQYYVLSSISGAGGGGLALGRATGQSCPEIVVQRRSDLDNGTPVIFSNADSKDDVVRVSTDVNIEF-VPIRDRLCSTSTVWRLDNYDNSAGKWWVTTDGVKGEPGPNTLCSWFKIEKAGVLG----YKFRFCPSVCDSCTTLC 180          
BLAST of CX295127 vs. ExPASy Swiss-Prot
Match: LSPI_CARPA (Latex serine proteinase inhibitor OS=Carica papaya PE=1 SV=1)

HSP 1 Score: 70.4774 bits (171), Expect = 6.146e-12
Identity = 50/150 (33.33%), Postives = 78/150 (52.00%), Query Frame = 3
Query:  102 EPVLDIIGNKVKSTLEYKLIPVLDGAGGFSTHL---GTNGQCPLDVIQLSSPSERGDNLRLLPYDNYK--IVKVSTDVNLRFPVKVSVKPCNEEPLWKVDSYDDPL---IVTGGSEGHPGAETLLNWFKIEKAG-NFSYGGVYNIVHCPS 524
            +P++DI G  V   ++Y ++  + GAGG    +   G   +CPL V+Q   P + G+ +      N K  IV  S D+N++F + ++   CNE   WKVD +   +   +  GG +G+ G E+  + FKI+KAG  FS    Y    CPS
Sbjct:    4 KPIVDIDGKPVLYGVDYFVVSAIWGAGGGGLTVYGPGNKKKCPLSVVQ--DPFDNGEPIIFSAIKNVKDNIVFESVDLNVKFNITIN---CNETTAWKVDRFPGVIGWTVTLGGEKGYHGFESTHSMFKIKKAGLPFS----YKFHFCPS 144          
The following BLAST results are available for this feature:
BLAST of CX295127 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 3
Match NameE-valueIdentityDescription
MIRA_RICDU4.695e-2037.21Miraculin OS=Richadella dulcifica PE=1 SV=3[more]
ASP_THECC4.695e-2036.7121 kDa seed protein OS=Theobroma cacao GN=ASP PE=2... [more]
LSPI_CARPA6.146e-1233.33Latex serine proteinase inhibitor OS=Carica papaya... [more]
back to top
Properties
Property NameValue
Genbank descriptionC05068H04SK DroRLeaf1 Citrus clementina cDNA clone C05068H04, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CX295127 ID=CX295127; Name=CX295127; organism=Citrus clementina; type=EST; length=552bp
CCTTCCAGTGGCAAAAAATGAAGACTTCATTGATAACAACACTCTCCTTC
CTTATCCTTACCTTGGCCACGCAGCCTCTATTGGGCATCTCATCAAACTC
TGAACCTGTCTTAGATATCATTGGCAACAAGGTCAAATCCACCCTCGAGT
ATAAACTTATCCCAGTCCTAGATGGCGCCGGTGGATTCAGCACACACCTA
GGCACAAATGGACAGTGTCCCTTGGACGTTATCCAATTAAGTTCTCCTAG
CGAAAGGGGAGATAATTTAAGATTACTTCCGTACGACAATTACAAAATTG
TCAAGGTATCCACTGATGTCAACCTGAGATTCCCCGTAAAAGTTTCTGTT
AAGCCCTGTAATGAAGAACCATTGTGGAAAGTTGATAGCTATGACGATCC
ATTAATTGTAACCGGCGGAAGTGAGGGCCACCCAGGAGCTGAAACGTTGC
TAAATTGGTTTAAGATTGAGAAAGCTGGAAATTTTTCATATGGTGGTGTA
TACAATATTGTCCATTGTCCGAGTGTCTGTCTATCTTGTCCTAGACGCTG
CA
back to top