CX295736

Overview
NameCX295736
Unique NameCX295736
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length706
Libraries
Library NameType
DroRLeaf1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig8146 contig Ccv1_Contig8146:579..1289. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CX295736 vs. ExPASy Swiss-Prot
Match: TPT_SPIOL (Triose phosphate/phosphate translocator, chloroplastic OS=Spinacia oleracea PE=1 SV=1)

HSP 1 Score: 393.275 bits (1009), Expect = 6.832e-109
Identity = 192/212 (90.57%), Postives = 206/212 (97.17%), Query Frame = 1
Query:    1 APIDSKFLKLLIPVAVCHALGHVTSNVSFAAVAVSFTHTIKALEPFFNAGASQFILGQQLPLTLWLSLAPVVIGVSMASLTELSFNWTGFISAMISNISFTYRSIYSKKAMTDMDSTNIYAYISIIALFVCIPPAIIVEGPQLIKHGLSDAISKVGMVKFISDLFWVGMFYHLYNQLATNTLERVAPLTHAVGNVLKRVFVIGFSILAFGNR 636
            AP+DSK LKLLIPVAVCHA+GHVTSNVSFAAVAVSFTHTIKALEPFFNA ASQF+LGQ +P+TLWLSLAPVVIGVSMASLTELSFNW GFISAMISN+SFTYRS+YSKKAMTDMDSTNIYAYISIIALFVC+PPAIIVEGPQL+KHG +DAI+KVG+ KFISDLFWVGMFYHLYNQLATNTLERVAPLTHAVGNVLKRVFVIGFSI+AFGN+
Sbjct:  157 APMDSKLLKLLIPVAVCHAIGHVTSNVSFAAVAVSFTHTIKALEPFFNAAASQFVLGQSIPITLWLSLAPVVIGVSMASLTELSFNWLGFISAMISNVSFTYRSLYSKKAMTDMDSTNIYAYISIIALFVCLPPAIIVEGPQLMKHGFNDAIAKVGLTKFISDLFWVGMFYHLYNQLATNTLERVAPLTHAVGNVLKRVFVIGFSIIAFGNK 368          
BLAST of CX295736 vs. ExPASy Swiss-Prot
Match: TPT1_BRAOB (Triose phosphate/phosphate translocator, chloroplastic OS=Brassica oleracea var. botrytis GN=TPT PE=2 SV=1)

HSP 1 Score: 384.415 bits (986), Expect = 3.174e-106
Identity = 187/212 (88.21%), Postives = 204/212 (96.23%), Query Frame = 1
Query:    1 APIDSKFLKLLIPVAVCHALGHVTSNVSFAAVAVSFTHTIKALEPFFNAGASQFILGQQLPLTLWLSLAPVVIGVSMASLTELSFNWTGFISAMISNISFTYRSIYSKKAMTDMDSTNIYAYISIIALFVCIPPAIIVEGPQLIKHGLSDAISKVGMVKFISDLFWVGMFYHLYNQLATNTLERVAPLTHAVGNVLKRVFVIGFSILAFGNR 636
            AP++S  LK+LIPVAVCHA+GHVTSNVSFAAVAVSFTHTIKALEPFFNA ASQF+LGQ +P+TLWLSLAPVV+GV+MASLTELSFNW GFISAMISNISFTYRSI+SKKAMTDMDSTN+YAYISIIALFVC+PPAIIVEGPQL+KHG +DAI+KVGM KFISDLFWVGMFYHLYNQLATNTLERVAPLTHAVGNVLKRVFVIGFSI+ FGN+
Sbjct:  160 APVNSDILKVLIPVAVCHAIGHVTSNVSFAAVAVSFTHTIKALEPFFNASASQFLLGQPIPITLWLSLAPVVLGVAMASLTELSFNWLGFISAMISNISFTYRSIFSKKAMTDMDSTNVYAYISIIALFVCLPPAIIVEGPQLLKHGFNDAIAKVGMTKFISDLFWVGMFYHLYNQLATNTLERVAPLTHAVGNVLKRVFVIGFSIVIFGNK 371          
BLAST of CX295736 vs. ExPASy Swiss-Prot
Match: TPT_FLAPR (Triose phosphate/phosphate translocator, chloroplastic OS=Flaveria pringlei GN=TPT PE=2 SV=1)

HSP 1 Score: 382.874 bits (982), Expect = 9.234e-106
Identity = 189/212 (89.15%), Postives = 200/212 (94.34%), Query Frame = 1
Query:    1 APIDSKFLKLLIPVAVCHALGHVTSNVSFAAVAVSFTHTIKALEPFFNAGASQFILGQQLPLTLWLSLAPVVIGVSMASLTELSFNWTGFISAMISNISFTYRSIYSKKAMTDMDSTNIYAYISIIALFVCIPPAIIVEGPQLIKHGLSDAISKVGMVKFISDLFWVGMFYHLYNQLATNTLERVAPLTHAVGNVLKRVFVIGFSILAFGNR 636
            AP+DS  LKLLIPVA CHALGHVTSNVSFAAVAVSFTHTIK+LEPFFNA ASQFILGQ +P+TLWLSLAPVVIGVSMASLTELSFNW GFISAMISNISFTYRSIYSKKAMTDMDSTN+YAYISII+L  CIPPAII+EGPQL+KHG SDAI+KVGM KFISDLFWVGMFYHLYNQLA NTLERVAPLTHAVGNVLKRVFVIGFSI+ FGN+
Sbjct:  161 APMDSNLLKLLIPVAFCHALGHVTSNVSFAAVAVSFTHTIKSLEPFFNAAASQFILGQSIPITLWLSLAPVVIGVSMASLTELSFNWLGFISAMISNISFTYRSIYSKKAMTDMDSTNLYAYISIISLLFCIPPAIILEGPQLLKHGFSDAIAKVGMTKFISDLFWVGMFYHLYNQLAINTLERVAPLTHAVGNVLKRVFVIGFSIIVFGNK 372          
BLAST of CX295736 vs. ExPASy Swiss-Prot
Match: TPT_PEA (Triose phosphate/phosphate translocator, chloroplastic OS=Pisum sativum PE=1 SV=1)

HSP 1 Score: 382.489 bits (981), Expect = 1.206e-105
Identity = 188/212 (88.68%), Postives = 201/212 (94.81%), Query Frame = 1
Query:    1 APIDSKFLKLLIPVAVCHALGHVTSNVSFAAVAVSFTHTIKALEPFFNAGASQFILGQQLPLTLWLSLAPVVIGVSMASLTELSFNWTGFISAMISNISFTYRSIYSKKAMTDMDSTNIYAYISIIALFVCIPPAIIVEGPQLIKHGLSDAISKVGMVKFISDLFWVGMFYHLYNQLATNTLERVAPLTHAVGNVLKRVFVIGFSILAFGNR 636
            APID   LKLLIPVAVCHALGHVTSNVSFAAVAVSFTHT+KALEPFFNA ASQFILGQ +P+TLWLSLAPVVIGVSMASLTELSFNW GFISAMISNISFTYRSIYSKKAMTDMDSTNIYAYISIIAL VCIPPA+I+EGP L+K G +DAI+KVG+VKF+SDLFWVGMFYHLYNQ+ATNTLERVAPLTHAVGNVLKRVFVIGFSI+ FGN+
Sbjct:  155 APIDGNLLKLLIPVAVCHALGHVTSNVSFAAVAVSFTHTVKALEPFFNAAASQFILGQSIPITLWLSLAPVVIGVSMASLTELSFNWLGFISAMISNISFTYRSIYSKKAMTDMDSTNIYAYISIIALIVCIPPALIIEGPTLLKTGFNDAIAKVGLVKFVSDLFWVGMFYHLYNQVATNTLERVAPLTHAVGNVLKRVFVIGFSIIIFGNK 366          
BLAST of CX295736 vs. ExPASy Swiss-Prot
Match: TPT_FLATR (Triose phosphate/phosphate translocator, chloroplastic OS=Flaveria trinervia GN=TPT PE=2 SV=1)

HSP 1 Score: 382.104 bits (980), Expect = 1.575e-105
Identity = 185/212 (87.26%), Postives = 200/212 (94.34%), Query Frame = 1
Query:    1 APIDSKFLKLLIPVAVCHALGHVTSNVSFAAVAVSFTHTIKALEPFFNAGASQFILGQQLPLTLWLSLAPVVIGVSMASLTELSFNWTGFISAMISNISFTYRSIYSKKAMTDMDSTNIYAYISIIALFVCIPPAIIVEGPQLIKHGLSDAISKVGMVKFISDLFWVGMFYHLYNQLATNTLERVAPLTHAVGNVLKRVFVIGFSILAFGNR 636
            AP+DS  LKLLIPV  CHALGHVTSNVSFAAVAVSFTHTIKALEPFFNA ASQF+LGQ +P++LWLSLAPVVIGVSMASLTELSFNW GFISAMISNISFTYRSIYSKKAMTDMDSTN+YAYISIIAL  CIPPA++ EGPQL+KHG +DAI+KVGM+KFISDLFWVGMFYHLYNQ+ATNTLERVAPLTHAVGNVLKRVFVIGFSI+ FGN+
Sbjct:  160 APVDSNILKLLIPVGFCHALGHVTSNVSFAAVAVSFTHTIKALEPFFNAAASQFVLGQSIPISLWLSLAPVVIGVSMASLTELSFNWLGFISAMISNISFTYRSIYSKKAMTDMDSTNLYAYISIIALLFCIPPAVLFEGPQLLKHGFNDAIAKVGMIKFISDLFWVGMFYHLYNQIATNTLERVAPLTHAVGNVLKRVFVIGFSIIVFGNK 371          
BLAST of CX295736 vs. ExPASy Swiss-Prot
Match: TPT_SOLTU (Triose phosphate/phosphate translocator, chloroplastic OS=Solanum tuberosum GN=TPT PE=2 SV=1)

HSP 1 Score: 372.474 bits (955), Expect = 1.248e-102
Identity = 181/212 (85.38%), Postives = 197/212 (92.92%), Query Frame = 1
Query:    1 APIDSKFLKLLIPVAVCHALGHVTSNVSFAAVAVSFTHTIKALEPFFNAGASQFILGQQLPLTLWLSLAPVVIGVSMASLTELSFNWTGFISAMISNISFTYRSIYSKKAMTDMDSTNIYAYISIIALFVCIPPAIIVEGPQLIKHGLSDAISKVGMVKFISDLFWVGMFYHLYNQLATNTLERVAPLTHAVGNVLKRVFVIGFSILAFGNR 636
            APIDS  LKLL PVA CHALGHVTSNVSFAAV VSFTHT+KALEPFFNA ASQFILGQQ+PL LWLSLAPVV+GVSMASLTELSFNW GF SAMISNISFTYRSIYSKKAMTDMDSTN+YAYISIIAL  C+PPAI +EGPQL++HG +DAI+KVG+ KF++DLFWVGMFYHLYNQ+ATNTLERVAPLTHAVGNVLKRVFVIGFSI+ FGN+
Sbjct:  167 APIDSTQLKLLTPVAFCHALGHVTSNVSFAAVRVSFTHTVKALEPFFNAAASQFILGQQIPLALWLSLAPVVLGVSMASLTELSFNWLGFTSAMISNISFTYRSIYSKKAMTDMDSTNVYAYISIIALIFCLPPAIFIEGPQLLQHGFNDAIAKVGLTKFVTDLFWVGMFYHLYNQVATNTLERVAPLTHAVGNVLKRVFVIGFSIVIFGNK 378          
BLAST of CX295736 vs. ExPASy Swiss-Prot
Match: TPT_MAIZE (Triose phosphate/phosphate translocator, chloroplastic OS=Zea mays GN=TPT PE=1 SV=1)

HSP 1 Score: 365.54 bits (937), Expect = 1.526e-100
Identity = 177/212 (83.49%), Postives = 198/212 (93.40%), Query Frame = 1
Query:    1 APIDSKFLKLLIPVAVCHALGHVTSNVSFAAVAVSFTHTIKALEPFFNAGASQFILGQQLPLTLWLSLAPVVIGVSMASLTELSFNWTGFISAMISNISFTYRSIYSKKAMTDMDSTNIYAYISIIALFVCIPPAIIVEGPQLIKHGLSDAISKVGMVKFISDLFWVGMFYHLYNQLATNTLERVAPLTHAVGNVLKRVFVIGFSILAFGNR 636
            API+   LKLL PVA+CH +GH+TSNVSFAAVAVSF HTIKALEPFF+A A+QFILGQQ+P +LWLSLAPVVIGVSMASLTELSFNWTGFI+AMISNISFTYRSIYSKKAMTDMDSTN+YAYISIIAL VCIPPA+I EGP+L++HG SDAI+KVG+ KF+SDLF VG+FYHLYNQ+ATNTLERVAPLTHAVGNVLKRVFVIGFSI+ FGN+
Sbjct:  163 APINGTLLKLLFPVALCHGIGHITSNVSFAAVAVSFAHTIKALEPFFSAAATQFILGQQVPFSLWLSLAPVVIGVSMASLTELSFNWTGFINAMISNISFTYRSIYSKKAMTDMDSTNVYAYISIIALIVCIPPALIFEGPKLMQHGFSDAIAKVGLTKFVSDLFLVGLFYHLYNQIATNTLERVAPLTHAVGNVLKRVFVIGFSIIVFGNK 374          
BLAST of CX295736 vs. ExPASy Swiss-Prot
Match: GPT1_ARATH (Glucose-6-phosphate/phosphate translocator 1, chloroplastic OS=Arabidopsis thaliana GN=GPT1 PE=2 SV=1)

HSP 1 Score: 185.652 bits (470), Expect = 2.164e-46
Identity = 101/225 (44.89%), Postives = 149/225 (66.22%), Query Frame = 1
Query:   10 DSKFLKLLIPVAVCHALGHVTSNVSFAAVAVSFTHTIKALEPFFNAGASQFILGQQLPLTLWLSLAPVVIGVSMASLTELSFNWTGFISAMISNISFTYRSIYSKKAM--TDMDSTNIYAYISIIALFVCIPPAIIVEGPQLIKHGLSDAISKVGMVKFISDLFWVGMFYHLYNQLATNTLERVAPLTHAVGNVLKRVFVIGFSILAFGNRSHP-NWYWTVIALL 675
            D  F K L PVAV H +GHV + VS + VAVSFTH IK+ EP F+   S+FILG+  P +++LSL P++ G ++++LTEL+FN  GF+ AMISN++F +R+I+SKK M    +   N YA +S+++L +  P AI VEGPQ+   G   A++ VG  +F+  +    +FYHLYNQ++  +L++++PLT +VGN +KR+ VI  SI+ F     P N     IA+L
Sbjct:  155 DFDFWKTLFPVAVAHTIGHVAATVSMSKVAVSFTHIIKSGEPAFSVLVSRFILGETFPTSVYLSLIPIIGGCALSALTELNFNMIGFMGAMISNLAFVFRNIFSKKGMKGKSVSGMNYYACLSMLSLLILTPFAIAVEGPQMWVDGWQTALATVG-PQFVWWVVAQSVFYHLYNQVSYMSLDQISPLTFSVGNTMKRISVIVSSIIIFRTPVQPVNALGAAIAIL 378          
BLAST of CX295736 vs. ExPASy Swiss-Prot
Match: GPT2_ARATH (Glucose-6-phosphate/phosphate translocator 2, chloroplastic OS=Arabidopsis thaliana GN=GPT2 PE=2 SV=1)

HSP 1 Score: 183.726 bits (465), Expect = 8.221e-46
Identity = 96/217 (44.24%), Postives = 147/217 (67.74%), Query Frame = 1
Query:   10 DSKFLKLLIPVAVCHALGHVTSNVSFAAVAVSFTHTIKALEPFFNAGASQFILGQQLPLTLWLSLAPVVIGVSMASLTELSFNWTGFISAMISNISFTYRSIYSKKAM--TDMDSTNIYAYISIIALFVCIPPAIIVEGPQLIKHGLSDAISKVGMVKFISDLFWV---GMFYHLYNQLATNTLERVAPLTHAVGNVLKRVFVIGFSILAFGNRSHP 645
            D +F K L PVAV H +GHV + VS + VAVSFTH IK+ EP F+   S+F +G+  PL ++LSL P++ G ++A++TEL+FN TGF+ AMISN++F +R+I+SKK M    +   N YA +S+++L +  P +I VE PQ+   G  +A+S+VG     + ++WV    +FYHLYNQ++  +L++++PLT ++GN +KR+ VI  SI+ F     P
Sbjct:  155 DLEFWKTLFPVAVAHTIGHVAATVSMSKVAVSFTHIIKSGEPAFSVLVSRFFMGETFPLPVYLSLLPIIGGCALAAITELNFNITGFMGAMISNLAFVFRNIFSKKGMKGKSVSGMNYYACLSMMSLVILTPFSIAVEVPQMWAAGWQNAVSQVGP----NFVWWVVAQSVFYHLYNQVSYMSLDQISPLTFSIGNTMKRISVIVASIIIFHTPIQP 367          
BLAST of CX295736 vs. ExPASy Swiss-Prot
Match: TPT2_BRAOB (Triose phosphate/phosphate translocator, non-green plastid, chloroplastic OS=Brassica oleracea var. botrytis GN=NGTPT PE=2 SV=1)

HSP 1 Score: 149.058 bits (375), Expect = 2.244e-35
Identity = 89/229 (38.86%), Postives = 140/229 (61.14%), Query Frame = 1
Query:    7 IDSKFLKLLIPVAVCHALGHVTSNVSFAAVAVSFTHTIKALEPFFNAGASQFILGQQLPLTLWL--SLAPVVIGVSMASLTELSFNWTGFISAMISNISFTYRSIYSKKAMT----DMDSTNIYAYISIIALFVCIPPAIIVEGPQLIKHGLSDAISKVGMVKFISDLFWVGMFYHLYNQLATNTLERVAPLTHAVGNVLKRVFVIGFSILAFGNRSHP-NWYWTVIAL 672
            I +  L  ++P+AV H LG++ +N+S   V+VSFTHTIKA+EPFF+   S   LG+ +P T W+  S+ P+V GV++AS+TE+SFNW GF+SAM SN++   R++ SKK M      +D+  +++ I++++LF+  P     EG +     +  A   V + +  +      + +H Y Q++   L RV+P+TH+VGN +KRV VI  S++ F     P N + T IAL
Sbjct:  159 ISAAQLAAILPLAVVHTLGNLFTNMSLGKVSVSFTHTIKAMEPFFSVVLSAMFLGE-VP-TPWVIGSIIPIVGGVALASVTEVSFNWAGFLSAMASNLTNQSRNVLSKKVMVKKDDSLDNITLFSIITLMSLFLMAPVTFFSEGIKFTPSYIQSA--GVNVQQIYTKSLIAALCFHAYQQVSYMILARVSPVTHSVGNCVKRVVVIVSSVIFFKTPVSPVNAFGTGIAL 383          
The following BLAST results are available for this feature:
BLAST of CX295736 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 17
Match NameE-valueIdentityDescription
TPT_SPIOL6.832e-10990.57Triose phosphate/phosphate translocator, chloropla... [more]
TPT1_BRAOB3.174e-10688.21Triose phosphate/phosphate translocator, chloropla... [more]
TPT_FLAPR9.234e-10689.15Triose phosphate/phosphate translocator, chloropla... [more]
TPT_PEA1.206e-10588.68Triose phosphate/phosphate translocator, chloropla... [more]
TPT_FLATR1.575e-10587.26Triose phosphate/phosphate translocator, chloropla... [more]
TPT_SOLTU1.248e-10285.38Triose phosphate/phosphate translocator, chloropla... [more]
TPT_MAIZE1.526e-10083.49Triose phosphate/phosphate translocator, chloropla... [more]
GPT1_ARATH2.164e-4644.89Glucose-6-phosphate/phosphate translocator 1, chlo... [more]
GPT2_ARATH8.221e-4644.24Glucose-6-phosphate/phosphate translocator 2, chlo... [more]
TPT2_BRAOB2.244e-3538.86Triose phosphate/phosphate translocator, non-green... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC05075D02SK DroRLeaf1 Citrus clementina cDNA clone C05075D02, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CX295736 ID=CX295736|Name=CX295736|organism=Citrus clementina|type=EST|length=706bp
GCTCCTATTGATTCAAAATTCCTGAAGCTGTTAATCCCTGTTGCTGTGTG
TCATGCATTGGGCCATGTTACCAGCAACGTGTCTTTTGCAGCAGTTGCTG
TCTCCTTTACTCATACCATCAAAGCTCTTGAGCCCTTCTTCAACGCTGGT
GCTTCACAATTCATTCTAGGCCAACAGTTACCTCTGACTCTGTGGCTGTC
TCTTGCTCCTGTGGTTATTGGAGTGTCAATGGCATCATTGACTGAGCTGT
CGTTCAATTGGACGGGCTTCATTAGTGCTATGATTTCCAACATATCGTTT
ACTTACAGGAGTATCTACTCCAAGAAAGCCATGACTGATATGGACAGTAC
TAATATTTATGCCTATATTTCCATCATTGCGCTCTTTGTCTGTATTCCAC
CAGCCATCATTGTTGAGGGACCTCAACTGATTAAGCATGGCTTAAGTGAT
GCAATTTCCAAAGTGGGCATGGTCAAGTTCATTTCAGATCTTTTTTGGGT
GGGGATGTTTTACCACCTCTACAATCAGTTGGCTACGAACACCTTGGAGA
GGGTTGCACCTCTTACTCATGCAGTTGGCAATGTGCTGAAACGTGTGTTT
GTGATTGGGTTCTCAATCCTGGCCTTTGGCAACAGATCTCACCCAAACTG
GTATTGGACAGTCATTGCATTGCTGGAGTGCAGCCTACTCTTACATCAGC
CCAATG
back to top