CX295750

Overview
NameCX295750
Unique NameCX295750
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length685
Libraries
Library NameType
DroRLeaf1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig1753 contig Ccv1_Contig1753:10..695. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CX295750 vs. ExPASy Swiss-Prot
Match: RIC2_ORYSJ (Ras-related protein RIC2 OS=Oryza sativa subsp. japonica GN=RIC2 PE=2 SV=2)

HSP 1 Score: 350.517 bits (898), Expect = 4.787e-96
Identity = 174/200 (87.00%), Postives = 190/200 (95.00%), Query Frame = 2
Query:   38 AGYRAEDDYDYLFKVVLIGDSGVGKSNLLSRFTRNEFSLESKSTIGVEFATRSLNVDGKVIKAQIWDTAGQERYRAITSAYYRGAVGALLVYDVTRHSTFENVERWLRELRDHTDPNIVVMLIGNKSDLRHLVAVSTEDGKSFAEKESLFFMETSALEATNVDNAFAEVLTQIYRIVSKKAMETGEDVGNSAVPSKERKL 637
            AGYRAEDDYDYLFKVVLIGDSGVGKSNLLSRFTRNEFSLESKSTIGVEFATRSL VDGKV+KAQIWDTAGQERYRAITSAYYRGAVGALLVYDVTRHSTFENVERWL+ELRDHTDPNIVVML+GNKSDLRHLVAV T++GK+FAE+ESL+FMETSALE+TNV+NAFAEVLTQIYRIVSK+++E G+D G+   P K  K+
Sbjct:    3 AGYRAEDDYDYLFKVVLIGDSGVGKSNLLSRFTRNEFSLESKSTIGVEFATRSLQVDGKVVKAQIWDTAGQERYRAITSAYYRGAVGALLVYDVTRHSTFENVERWLKELRDHTDPNIVVMLVGNKSDLRHLVAVQTDEGKAFAERESLYFMETSALESTNVENAFAEVLTQIYRIVSKRSVEAGDDAGSG--PGKGEKI 200          
BLAST of CX295750 vs. ExPASy Swiss-Prot
Match: RAA1C_ARATH (Ras-related protein RABA1c OS=Arabidopsis thaliana GN=RABA1C PE=1 SV=1)

HSP 1 Score: 344.739 bits (883), Expect = 2.627e-94
Identity = 176/201 (87.56%), Postives = 187/201 (93.03%), Query Frame = 2
Query:   35 MAGYRAEDDYDYLFKVVLIGDSGVGKSNLLSRFTRNEFSLESKSTIGVEFATRSLNVDGKVIKAQIWDTAGQERYRAITSAYYRGAVGALLVYDVTRHSTFENVERWLRELRDHTDPNIVVMLIGNKSDLRHLVAVSTEDGKSFAEKESLFFMETSALEATNVDNAFAEVLTQIYRIVSKKAMETGEDVGNSAVPSKERKL 637
            MAGYRA+D+YDYLFKVVLIGDSGVGKSNLLSRFT+NEFSLESKSTIGVEFATRSLNVD KVIKAQIWDTAGQERYRAITSAYYRGAVGALLVYDVTRHSTFENVE WL+ELR+HTDPNIVVML+GNKSDLRHLVAV TED KSFAEKESL+FMETSALEATNV+NAFAEVLTQI+ IVSKKAME   +  N  VPSK  K+
Sbjct:    1 MAGYRADDEYDYLFKVVLIGDSGVGKSNLLSRFTKNEFSLESKSTIGVEFATRSLNVDDKVIKAQIWDTAGQERYRAITSAYYRGAVGALLVYDVTRHSTFENVETWLKELRNHTDPNIVVMLVGNKSDLRHLVAVQTEDAKSFAEKESLYFMETSALEATNVENAFAEVLTQIHHIVSKKAMEAASESAN--VPSKGDKI 199          
BLAST of CX295750 vs. ExPASy Swiss-Prot
Match: RB11E_LOTJA (Ras-related protein Rab11E OS=Lotus japonicus GN=RAB11E PE=2 SV=1)

HSP 1 Score: 341.273 bits (874), Expect = 2.904e-93
Identity = 169/197 (85.79%), Postives = 186/197 (94.42%), Query Frame = 2
Query:   35 MAGYRAEDDYDYLFKVVLIGDSGVGKSNLLSRFTRNEFSLESKSTIGVEFATRSLNVDGKVIKAQIWDTAGQERYRAITSAYYRGAVGALLVYDVTRHSTFENVERWLRELRDHTDPNIVVMLIGNKSDLRHLVAVSTEDGKSFAEKESLFFMETSALEATNVDNAFAEVLTQIYRIVSKKAMETGEDVGNSAVPSK 625
            MAGY+A+D+YDYLFK+VLIGDSGVGKSNLLSRFTRNEF+LESKSTIGVEFAT+SLN+DGKVIKAQIWDTAGQERYRAITSAYYRGAVGALLVYDVTR +TFE   RWL+ELRDHTDPNIVVMLIGNKSDLRHLV VSTEDGK+FAEKESL+FMETSALEATNV+NAF+EVLTQIYRIVSK+A+E G+    S VPS+
Sbjct:    1 MAGYKADDEYDYLFKLVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATKSLNIDGKVIKAQIWDTAGQERYRAITSAYYRGAVGALLVYDVTRSTTFETAGRWLKELRDHTDPNIVVMLIGNKSDLRHLVTVSTEDGKAFAEKESLYFMETSALEATNVENAFSEVLTQIYRIVSKRAVEAGDRPSTSVVPSQ 197          
BLAST of CX295750 vs. ExPASy Swiss-Prot
Match: RAA1B_ARATH (Ras-related protein RABA1b OS=Arabidopsis thaliana GN=RABA1B PE=2 SV=1)

HSP 1 Score: 339.732 bits (870), Expect = 8.450e-93
Identity = 169/199 (84.92%), Postives = 188/199 (94.47%), Query Frame = 2
Query:   35 MAGYRAEDDYDYLFKVVLIGDSGVGKSNLLSRFTRNEFSLESKSTIGVEFATRSLNVDGKVIKAQIWDTAGQERYRAITSAYYRGAVGALLVYDVTRHSTFENVERWLRELRDHTDPNIVVMLIGNKSDLRHLVAVSTEDGKSFAEKESLFFMETSALEATNVDNAFAEVLTQIYRIVSKKAMETGEDVGNSAVPSKER 631
            MAGYR EDDYDYLFKVVLIGDSGVGKSNLLSRFT+NEF+LESKSTIGVEFATR+L VDGKV+KAQIWDTAGQERYRAITSAYYRGAVGALLVYDVTR +TFENV+RWL+EL++HTDPNIVVML+GNKSDLRHL+AV TEDGKS+AE+ESL FMETSALEATNV++AFAEVLTQIYRI SKK +E GED GN++VP  E+
Sbjct:    1 MAGYRVEDDYDYLFKVVLIGDSGVGKSNLLSRFTKNEFNLESKSTIGVEFATRTLKVDGKVVKAQIWDTAGQERYRAITSAYYRGAVGALLVYDVTRRATFENVDRWLKELKNHTDPNIVVMLVGNKSDLRHLLAVPTEDGKSYAEQESLCFMETSALEATNVEDAFAEVLTQIYRITSKKQVEAGED-GNASVPKGEK 198          
BLAST of CX295750 vs. ExPASy Swiss-Prot
Match: RB11D_LOTJA (Ras-related protein Rab11D OS=Lotus japonicus GN=RAB11D PE=2 SV=1)

HSP 1 Score: 338.191 bits (866), Expect = 2.459e-92
Identity = 166/197 (84.26%), Postives = 184/197 (93.40%), Query Frame = 2
Query:   35 MAGYRAEDDYDYLFKVVLIGDSGVGKSNLLSRFTRNEFSLESKSTIGVEFATRSLNVDGKVIKAQIWDTAGQERYRAITSAYYRGAVGALLVYDVTRHSTFENVERWLRELRDHTDPNIVVMLIGNKSDLRHLVAVSTEDGKSFAEKESLFFMETSALEATNVDNAFAEVLTQIYRIVSKKAMETGEDVGNSAVPSK 625
            M GYR +D+YDYLFK+VLIGDSGVGKSNLLSRFT+NEF+LESKSTIGVEFAT++LNVD KV+KAQIWDTAGQERYRAITSAYYRGAVGALLVYDVTR +TFEN  RWL+ELRDHTDPNIVVMLIGNKSDLRHLVAV TEDGKSFAE+ESL+FMETSALEATNV+NAF EVLTQIYRIVSK+A+E G+   +S +PSK
Sbjct:    1 MGGYRTDDEYDYLFKLVLIGDSGVGKSNLLSRFTKNEFNLESKSTIGVEFATKTLNVDAKVVKAQIWDTAGQERYRAITSAYYRGAVGALLVYDVTRRATFENAARWLKELRDHTDPNIVVMLIGNKSDLRHLVAVPTEDGKSFAERESLYFMETSALEATNVENAFTEVLTQIYRIVSKRAVEAGDSGSSSGLPSK 197          
BLAST of CX295750 vs. ExPASy Swiss-Prot
Match: YPT3_NICPL (Ras-related protein YPT3 OS=Nicotiana plumbaginifolia GN=YPT3 PE=2 SV=1)

HSP 1 Score: 334.339 bits (856), Expect = 3.550e-91
Identity = 164/197 (83.25%), Postives = 182/197 (92.39%), Query Frame = 2
Query:   35 MAGYRAEDDYDYLFKVVLIGDSGVGKSNLLSRFTRNEFSLESKSTIGVEFATRSLNVDGKVIKAQIWDTAGQERYRAITSAYYRGAVGALLVYDVTRHSTFENVERWLRELRDHTDPNIVVMLIGNKSDLRHLVAVSTEDGKSFAEKESLFFMETSALEATNVDNAFAEVLTQIYRIVSKKAMETGEDVGNSAVPSK 625
            MAGYRA+D+YDYLFK+VLIGDSGVGKSNLLSRFT+NEF+LESKSTIGVEFAT+SLN+D KVIKAQIWDTAGQERYRAITSAYYRGAVGALLVYDVTRH T+ENV RWL+ELRDHTDPNIVVMLIGNKSDLRHLVAVST++ K  AE+E L+FMETSALEATNV+NAF E LTQIYRIVSKKA+E G++   S+ P K
Sbjct:    1 MAGYRADDEYDYLFKLVLIGDSGVGKSNLLSRFTKNEFNLESKSTIGVEFATKSLNIDNKVIKAQIWDTAGQERYRAITSAYYRGAVGALLVYDVTRHVTYENVTRWLKELRDHTDPNIVVMLIGNKSDLRHLVAVSTDEAKGLAEREGLYFMETSALEATNVENAFTEALTQIYRIVSKKAVEAGDEGATSSAPPK 197          
BLAST of CX295750 vs. ExPASy Swiss-Prot
Match: RB11B_TOBAC (Ras-related protein Rab11B OS=Nicotiana tabacum GN=RAB11B PE=2 SV=1)

HSP 1 Score: 318.931 bits (816), Expect = 1.544e-86
Identity = 152/186 (81.72%), Postives = 175/186 (94.09%), Query Frame = 2
Query:   41 GYRAEDDYDYLFKVVLIGDSGVGKSNLLSRFTRNEFSLESKSTIGVEFATRSLNVDGKVIKAQIWDTAGQERYRAITSAYYRGAVGALLVYDVTRHSTFENVERWLRELRDHTDPNIVVMLIGNKSDLRHLVAVSTEDGKSFAEKESLFFMETSALEATNVDNAFAEVLTQIYRIVSKKAMETGED 598
            GYRAEDDYDYLFK+VLIGDSGVGKSNLLSRF+RNEF+LESKSTIGVEFATRS+ VD K++KAQIWDTAGQERYRAITSAYYRGAVGAL+VYD+TRH TFENVERWL+ELRDHTD NIV+ML+GNK+DLRHL AVSTED K+FAE+E+ FFMETSALE+ NV+NAF EVLT+IY++V +KA+E G+D
Sbjct:    4 GYRAEDDYDYLFKLVLIGDSGVGKSNLLSRFSRNEFNLESKSTIGVEFATRSIRVDDKIVKAQIWDTAGQERYRAITSAYYRGAVGALVVYDITRHVTFENVERWLKELRDHTDQNIVIMLVGNKADLRHLRAVSTEDAKAFAERENTFFMETSALESLNVENAFTEVLTEIYKVVCRKALEVGDD 189          
BLAST of CX295750 vs. ExPASy Swiss-Prot
Match: RAA1A_ARATH (Ras-related protein RABA1a OS=Arabidopsis thaliana GN=RABA1A PE=2 SV=1)

HSP 1 Score: 315.849 bits (808), Expect = 1.307e-85
Identity = 157/198 (79.29%), Postives = 182/198 (91.92%), Query Frame = 2
Query:   35 MAGYRAEDDYDYLFKVVLIGDSGVGKSNLLSRFTRNEFSLESKSTIGVEFATRSLNVDGKVIKAQIWDTAGQERYRAITSAYYRGAVGALLVYDVTRHSTFENVERWLRELRDHTDPNIVVMLIGNKSDLRHLVAVSTEDGKSFAEKESLFFMETSALEATNVDNAFAEVLTQIYRIVSKKAMETGEDVGNSA-VPSK 625
            MAGYRA+++YDYLFK+VLIGDSGVGKSNLLSRFT+NEF+LESKSTIGVEFAT++  V+GKV+KAQIWDTAGQERYRAITSAYYRGAVGALL+YDVTRH+TFEN  RWLRELR HTDPNIVVMLIGNK DLRHLVAV TE+ K+FAE+ESL+FMETSAL+ATNV+NAF EVLTQI++IVSK++++ G   G SA +P K
Sbjct:    1 MAGYRADEEYDYLFKLVLIGDSGVGKSNLLSRFTKNEFNLESKSTIGVEFATKTTKVEGKVVKAQIWDTAGQERYRAITSAYYRGAVGALLIYDVTRHATFENAARWLRELRGHTDPNIVVMLIGNKCDLRHLVAVKTEEAKAFAERESLYFMETSALDATNVENAFTEVLTQIHKIVSKRSVDGG---GESADLPGK 195          
BLAST of CX295750 vs. ExPASy Swiss-Prot
Match: YPTC6_CHLRE (Ras-related protein YPTC6 OS=Chlamydomonas reinhardtii GN=YPTC6 PE=3 SV=1)

HSP 1 Score: 290.812 bits (743), Expect = 4.501e-78
Identity = 141/185 (76.22%), Postives = 165/185 (89.19%), Query Frame = 2
Query:   44 YRAEDDYDYLFKVVLIGDSGVGKSNLLSRFTRNEFSLESKSTIGVEFATRSLNVDGKVIKAQIWDTAGQERYRAITSAYYRGAVGALLVYDVTRHSTFENVERWLRELRDHTDPNIVVMLIGNKSDLRHLVAVSTEDGKSFAEKESLFFMETSALEATNVDNAFAEVLTQIYRIVSKKAMETGED 598
            ++ +DDYDYLFKVVLIGDSGVGKSNLLSRFTRNEFSLESKSTIGVEFATRS+ VDGK IKAQIWDTAGQERYRAITSAYYRGAVGALLVYD+T+  TFENVERWL+ELRDH D NIV+ML+GNKSDL+HL  V TE  ++F E+E L F+ETSALE+TNV+ AF ++LT+IY IVSKK +++ ++
Sbjct:    3 HKPDDDYDYLFKVVLIGDSGVGKSNLLSRFTRNEFSLESKSTIGVEFATRSIQVDGKTIKAQIWDTAGQERYRAITSAYYRGAVGALLVYDITKSVTFENVERWLKELRDHADSNIVIMLVGNKSDLKHLRDVQTEVAQAFCEREGLSFIETSALESTNVEKAFQQILTEIYHIVSKKVLDSEDN 187          
BLAST of CX295750 vs. ExPASy Swiss-Prot
Match: RB11A_RAT (Ras-related protein Rab-11A OS=Rattus norvegicus GN=Rab11a PE=1 SV=3)

HSP 1 Score: 290.041 bits (741), Expect = 7.678e-78
Identity = 144/193 (74.61%), Postives = 166/193 (86.01%), Query Frame = 2
Query:   53 EDDYDYLFKVVLIGDSGVGKSNLLSRFTRNEFSLESKSTIGVEFATRSLNVDGKVIKAQIWDTAGQERYRAITSAYYRGAVGALLVYDVTRHSTFENVERWLRELRDHTDPNIVVMLIGNKSDLRHLVAVSTEDGKSFAEKESLFFMETSALEATNVDNAFAEVLTQIYRIVSKKAM----ETGEDVGNSAVP 619
            +D+YDYLFKVVLIGDSGVGKSNLLSRFTRNEF+LESKSTIGVEFATRS+ VDGK IKAQIWDTAGQERYRAITSAYYRGAVGALLVYD+ +H T+ENVERWL+ELRDH D NIV+ML+GNKSDLRHL AV T++ ++FAEK  L F+ETSAL++TNV+ AF  +LT+IYRIVS+K M    E      N+ VP
Sbjct:    5 DDEYDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSIQVDGKTIKAQIWDTAGQERYRAITSAYYRGAVGALLVYDIAKHLTYENVERWLKELRDHADSNIVIMLVGNKSDLRHLRAVPTDEARAFAEKNGLSFIETSALDSTNVEAAFQTILTEIYRIVSQKQMSDRRENDMSPSNNVVP 197          
The following BLAST results are available for this feature:
BLAST of CX295750 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
RIC2_ORYSJ4.787e-9687.00Ras-related protein RIC2 OS=Oryza sativa subsp. ja... [more]
RAA1C_ARATH2.627e-9487.56Ras-related protein RABA1c OS=Arabidopsis thaliana... [more]
RB11E_LOTJA2.904e-9385.79Ras-related protein Rab11E OS=Lotus japonicus GN=R... [more]
RAA1B_ARATH8.450e-9384.92Ras-related protein RABA1b OS=Arabidopsis thaliana... [more]
RB11D_LOTJA2.459e-9284.26Ras-related protein Rab11D OS=Lotus japonicus GN=R... [more]
YPT3_NICPL3.550e-9183.25Ras-related protein YPT3 OS=Nicotiana plumbaginifo... [more]
RB11B_TOBAC1.544e-8681.72Ras-related protein Rab11B OS=Nicotiana tabacum GN... [more]
RAA1A_ARATH1.307e-8579.29Ras-related protein RABA1a OS=Arabidopsis thaliana... [more]
YPTC6_CHLRE4.501e-7876.22Ras-related protein YPTC6 OS=Chlamydomonas reinhar... [more]
RB11A_RAT7.678e-7874.61Ras-related protein Rab-11A OS=Rattus norvegicus G... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC05075E05SK DroRLeaf1 Citrus clementina cDNA clone C05075E05, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CX295750 ID=CX295750|Name=CX295750|organism=Citrus clementina|type=EST|length=685bp
GAGGAGAGTGTGAAGATATAAAGTTGCAATAGCTATGGCTGGATACAGAG
CTGAAGATGACTATGATTATCTTTTTAAGGTGGTTTTGATCGGTGACTCC
GGTGTCGGCAAGTCCAATTTGCTTTCGAGGTTCACTAGGAACGAGTTTAG
TCTCGAGTCTAAGTCCACAATAGGTGTTGAGTTCGCTACTCGTAGCTTGA
ATGTCGATGGCAAAGTCATCAAAGCTCAGATTTGGGACACCGCCGGCCAA
GAAAGGTACCGTGCCATAACCAGTGCATACTACCGAGGAGCTGTCGGGGC
ACTTCTAGTGTATGACGTCACTCGGCATTCCACATTTGAAAATGTGGAAA
GGTGGTTAAGGGAGTTGAGGGATCACACAGATCCCAACATTGTGGTTATG
CTCATTGGTAATAAATCGGATCTCCGTCACCTGGTGGCTGTCTCAACAGA
GGACGGGAAATCATTTGCTGAGAAGGAATCTCTCTTCTTCATGGAAACTT
CTGCTCTGGAGGCTACTAATGTGGACAATGCATTTGCTGAAGTGCTGACT
CAAATCTACCGTATTGTGAGCAAGAAGGCCATGGAGACAGGTGAGGATGT
AGGAAATTCTGCTGTACCTTCCAAGGAGAGAAAATTGATGTCAGTAAAGA
TGTGTCTGCTGTGAAGAAGGTGGCTGCTGCTCACT
back to top