CX295776

Overview
NameCX295776
Unique NameCX295776
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length772
Libraries
Library NameType
DroRLeaf1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of CX295776 vs. ExPASy Swiss-Prot
Match: SUBL_ARATH (Subtilisin-like protease OS=Arabidopsis thaliana GN=ARA12 PE=1 SV=1)

HSP 1 Score: 164.466 bits (415), Expect = 5.983e-40
Identity = 100/225 (44.44%), Postives = 141/225 (62.67%), Query Frame = 3
Query:   18 GKIILCFSRPDTQDIQSAAISVTQAGGVGLIYAQFHTDGLD---SCNLIPCIKVNYEVGTQILSYIRRARSPIAKLSSPETVIGDLVSPRVASFSSRGPNSMSPAVLKPDIVAPGVDILSAYP----PIG----SKDIQGYALLSGTSMSCPHVAGIAALIKSLHRDWSPAAIRSALVTTASQTGTDGMNIFEEGSTRKEANPFDIGGGHVNPNRQ*IQGLFMTL 659
            GKI++C  R     +Q   + V  AGGVG+I A    +G +     +L+P   V  + G  I  Y+    +P A +S   TV+G   SP VA+FSSRGPNS++P +LKPD++APGV+IL+A+     P G    S+ ++ + ++SGTSMSCPHV+G+AAL+KS+H +WSPAAIRSAL+TTA +T  DG  + +  +T K + PFD G GHV+P      GL   L
Sbjct:  398 GKIVMC-DRGINARVQKGDV-VKAAGGVGMILANTAANGEELVADAHLLPATTVGEKAGDIIRHYVTTDPNPTASISILGTVVGVKPSPVVAAFSSRGPNSITPNILKPDLIAPGVNILAAWTGAAGPTGLASDSRRVE-FNIISGTSMSCPHVSGLAALLKSVHPEWSPAAIRSALMTTAYKTYKDGKPLLDI-ATGKPSTPFDHGAGHVSPTTATNPGLIYDL 618          
BLAST of CX295776 vs. ExPASy Swiss-Prot
Match: XSP1_ARATH (Xylem serine proteinase 1 OS=Arabidopsis thaliana GN=XSP1 PE=2 SV=1)

HSP 1 Score: 126.716 bits (317), Expect = 2.607e-32
Identity = 86/219 (39.27%), Postives = 116/219 (52.97%), Query Frame = 3
Query:   18 GKIILCFSRPDTQDIQSAAISVTQAGGVGLIYAQFHTDGLDSCNLI--PCIKVNYEVGTQILSYIRRARSPIAKLSSPETVIGDLVSPRVASFSSRGPNSMSPAVLKPDIVAPGVDILSAYPPI-------GSKDIQGYALLSGTSMSCPHVAGIAALIKSLHRDWSPAAIRSALVTTASQTGTDGMNIFEEGSTRKEANPFDIGGGHVNPNRQ*IQGL 647
            GK+++C  R     ++S   S   AG + ++  Q+    LD+  +   P   VN  VG  I  YI   RS  A +     V   + +P VASFSSRGPN  S  +LKPDI APG+DIL+A+          G      + +LSGTSM+CPHVAG+AA +KS H DW+PAAI+SA++T+A                 K+A  F  GGG +NP R    GL
Sbjct:  400 GKVMVC--RMGGGGVESTIKSYGGAGAI-IVSDQY----LDNAQIFMAPATSVNSSVGDIIYRYINSTRSASAVIQKTRQVT--IPAPFVASFSSRGPNPGSIRLLKPDIAAPGIDILAAFTLKRSLTGLDGDTQFSKFTILSGTSMACPHVAGVAAYVKSFHPDWTPAAIKSAIITSAKPISR---------RVNKDAE-FAYGGGQINPRRAASPGL 599          

HSP 2 Score: 31.5722 bits (70), Expect = 2.607e-32
Identity = 13/25 (52.00%), Postives = 18/25 (72.00%), Query Frame = 2
Query:  626 QAMNPGLVYDITVEDYIQFLCFMGH 700
            +A +PGLVYD+    Y+QFLC  G+
Sbjct:  593 RAASPGLVYDMDDISYVQFLCGEGY 617          
BLAST of CX295776 vs. ExPASy Swiss-Prot
Match: CUCM1_CUCME (Cucumisin OS=Cucumis melo PE=1 SV=1)

HSP 1 Score: 110.153 bits (274), Expect = 2.681e-28
Identity = 80/212 (37.74%), Postives = 110/212 (51.89%), Query Frame = 3
Query:    9 LAAGKIILCFSRPDTQDIQSAAISVTQAGGVGLIYAQFHTDGLDSCNLIPCIKVNYEVGTQILSYIRRARSPIAKLSSPETVIGDLVSPRVASFSSRGPNSMSPAVLKPDIVAPGVDILSAYPPI----GSKDIQGYALLSGTSMSCPHVAGIAALIKSLHRDWSPAAIRSALVTTASQTGTDGMNIFEEGSTRKEANP---FDIGGGHVNP 623
            L  GKI++C +     +   +       G  G++      D  DS  L P   ++       L YI   RSP A +    T++ +  +P V SFSSRGPN  +  V+KPDI  PGV+IL+A+P +    G +    + ++SGTSMSCPH+ GIA  +K+ +  WSPAAI+SAL+TTAS      MN           NP   F  G GHVNP
Sbjct:  389 LLKGKIVVCEASFGPHEFFKSL-----DGAAGVLMTSNTRDYADSYPL-PSSVLDPNDLLATLRYIYSIRSPGATIFKSTTIL-NASAPVVVSFSSRGPNRATKDVIKPDISGPGVEILAAWPSVAPVGGIRRNTLFNIISGTSMSCPHITGIATYVKTYNPTWSPAAIKSALMTTASP-----MN--------ARFNPQAEFAYGSGHVNP 580          

HSP 2 Score: 34.6538 bits (78), Expect = 2.681e-28
Identity = 13/25 (52.00%), Postives = 18/25 (72.00%), Query Frame = 2
Query:  626 QAMNPGLVYDITVEDYIQFLCFMGH 700
            +A+ PGLVYD    DY++FLC  G+
Sbjct:  582 KAVRPGLVYDANESDYVKFLCGQGY 606          
BLAST of CX295776 vs. ExPASy Swiss-Prot
Match: SUBV_BACSU (Minor extracellular protease vpr OS=Bacillus subtilis GN=vpr PE=1 SV=1)

HSP 1 Score: 80.8777 bits (198), Expect = 8.699e-15
Identity = 52/156 (33.33%), Postives = 83/156 (53.21%), Query Frame = 3
Query:   72 AISVTQAGGVGLIYAQFHTDGLDSCNL----IPCIKVNYEVGTQILSYIRRARSPIAKLSSPETVIGDLVSPRVASFSSRGPNSMSPAVLKPDIVAPGVDILSAYPPIGSKDIQGYALLSGTSMSCPHVAGIAALIKSLHRDWSPAAIRSALVTTA 527
            A +  +AG +G++    +  G    N+    +P IK++ E G +++S ++   +      +    +G+    +VA FSSRGP  M   ++KPDI APGV+I+S  P        GY    GTSM+ PH+AG  A+IK     WS   I++A++ TA
Sbjct:  418 ADNAKKAGAIGMVVYN-NLSGEIEANVPGMSVPTIKLSLEDGEKLVSALKAGETKTTFKLTVSKALGE----QVADFSSRGP-VMDTWMIKPDISAPGVNIVSTIPTHDPDHPYGYGSKQGTSMASPHIAGAVAVIKQAKPKWSVEQIKAAIMNTA 567          
BLAST of CX295776 vs. ExPASy Swiss-Prot
Match: PRTM_BACSK (M-protease OS=Bacillus clausii (strain KSM-K16) GN=aprE PE=1 SV=2)

HSP 1 Score: 68.5514 bits (166), Expect = 4.468e-11
Identity = 41/84 (48.81%), Postives = 51/84 (60.71%), Query Frame = 3
Query:  336 DIVAPGVDILSAYPPIGSKDIQGYALLSGTSMSCPHVAGIAALIKSLHRDWSPAAIRSALVTTASQTGTDGMNIFEEGSTRKEA 587
            DIVAPGV++ S YP  GS     YA L+GTSM+ PHVAG+AAL+K  +  WS   IR+ L  TA  TG    N++  G    EA
Sbjct:  302 DIVAPGVNVQSTYP--GST----YASLNGTSMATPHVAGVAALVKQKNPSWSNVQIRNHLKNTA--TGLGNTNLYGSGLVNAEA 377          
The following BLAST results are available for this feature:
BLAST of CX295776 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 5
Match NameE-valueIdentityDescription
SUBL_ARATH5.983e-4044.44Subtilisin-like protease OS=Arabidopsis thaliana G... [more]
XSP1_ARATH2.607e-3239.27Xylem serine proteinase 1 OS=Arabidopsis thaliana ... [more]
CUCM1_CUCME2.681e-2837.74Cucumisin OS=Cucumis melo PE=1 SV=1[more]
SUBV_BACSU8.699e-1533.33Minor extracellular protease vpr OS=Bacillus subti... [more]
PRTM_BACSK4.468e-1148.81M-protease OS=Bacillus clausii (strain KSM-K16) GN... [more]
back to top
Properties
Property NameValue
Genbank descriptionC05075G07SK DroRLeaf1 Citrus clementina cDNA clone C05075G07, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CX295776 ID=CX295776|Name=CX295776|organism=Citrus clementina|type=EST|length=772bp
ATGAGACATTAGCTGCAGGAAAAATCATTCTATGCTTTTCAAGACCAGAC
ACACAGGACATACAGTCTGCCGCAATTTCTGTGACGCAAGCAGGAGGGGT
TGGACTCATATATGCGCAGTTTCATACCGACGGGCTTGACTCTTGCAATT
TGATTCCCTGTATTAAAGTAAATTATGAAGTAGGGACACAAATTCTCTCC
TATATTAGAAGAGCAAGGTCTCCGATTGCAAAGCTGAGTTCTCCCGAGAC
TGTTATTGGGGATTTGGTATCTCCAAGAGTTGCATCCTTCTCATCCAGAG
GACCTAATTCAATGTCCCCAGCTGTATTGAAGCCTGACATAGTTGCACCG
GGTGTGGATATCTTATCCGCATATCCACCAATTGGCTCAAAGGACATCCA
AGGGTATGCACTGCTATCAGGAACTTCAATGTCTTGCCCCCATGTAGCAG
GAATAGCAGCACTCATAAAATCTTTACATCGAGACTGGTCCCCAGCAGCC
ATAAGATCAGCTCTAGTTACAACCGCTTCTCAAACCGGAACAGACGGAAT
GAACATATTTGAGGAAGGCTCTACTCGCAAGGAAGCAAACCCATTTGACA
TAGGGGGCGGGCATGTTAATCCTAACAGGCAATGAATCCAGGGCTTGTTT
ATGACATTACAGTAGAGGACTATATCCAGTTCCTCTGCTTCATGGGTCAC
ACGATGCATCATCAGCAGATGACCAGTCCAAAATCACTGCTGAAAACACA
TCTCGCTCTGGACTTAACTCCA
back to top