CX296269

Overview
NameCX296269
Unique NameCX296269
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length198
Libraries
Library NameType
FerrChloL1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig10914 contig Ccv1_Contig10914:354..551. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CX296269 vs. ExPASy Swiss-Prot
Match: UBL1_ORYSJ (Ubiquitin-like protein 1 OS=Oryza sativa subsp. japonica GN=UBL1 PE=3 SV=1)

HSP 1 Score: 95.5153 bits (236), Expect = 8.908e-20
Identity = 46/46 (100.00%), Postives = 46/46 (100.00%), Query Frame = 2
Query:   20 QDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 157
            QDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct:   31 QDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 76          
BLAST of CX296269 vs. ExPASy Swiss-Prot
Match: UBIQ_WHEAT (Ubiquitin OS=Triticum aestivum PE=3 SV=1)

HSP 1 Score: 95.5153 bits (236), Expect = 8.908e-20
Identity = 46/46 (100.00%), Postives = 46/46 (100.00%), Query Frame = 2
Query:   20 QDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 157
            QDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct:   31 QDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 76          
BLAST of CX296269 vs. ExPASy Swiss-Prot
Match: UBIQ_TRYCR (Ubiquitin OS=Trypanosoma cruzi PE=3 SV=1)

HSP 1 Score: 95.5153 bits (236), Expect = 8.908e-20
Identity = 46/46 (100.00%), Postives = 46/46 (100.00%), Query Frame = 2
Query:   20 QDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 157
            QDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct:   31 QDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 76          
BLAST of CX296269 vs. ExPASy Swiss-Prot
Match: UBIQ_SOYBN (Ubiquitin OS=Glycine max GN=SUBI-1 PE=3 SV=1)

HSP 1 Score: 95.5153 bits (236), Expect = 8.908e-20
Identity = 46/46 (100.00%), Postives = 46/46 (100.00%), Query Frame = 2
Query:   20 QDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 157
            QDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct:   31 QDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 76          
BLAST of CX296269 vs. ExPASy Swiss-Prot
Match: UBIQ_SOLTU (Ubiquitin OS=Solanum tuberosum GN=UBI3 PE=3 SV=1)

HSP 1 Score: 95.5153 bits (236), Expect = 8.908e-20
Identity = 46/46 (100.00%), Postives = 46/46 (100.00%), Query Frame = 2
Query:   20 QDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 157
            QDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct:   31 QDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 76          
BLAST of CX296269 vs. ExPASy Swiss-Prot
Match: UBIQ_SOLLC (Ubiquitin OS=Solanum lycopersicum GN=UBI3 PE=3 SV=1)

HSP 1 Score: 95.5153 bits (236), Expect = 8.908e-20
Identity = 46/46 (100.00%), Postives = 46/46 (100.00%), Query Frame = 2
Query:   20 QDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 157
            QDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct:   31 QDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 76          
BLAST of CX296269 vs. ExPASy Swiss-Prot
Match: UBIQ_PETCR (Ubiquitin OS=Petroselinum crispum GN=PCUBI4-1 PE=3 SV=1)

HSP 1 Score: 95.5153 bits (236), Expect = 8.908e-20
Identity = 46/46 (100.00%), Postives = 46/46 (100.00%), Query Frame = 2
Query:   20 QDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 157
            QDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct:   31 QDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 76          
BLAST of CX296269 vs. ExPASy Swiss-Prot
Match: UBIQ_PEA (Ubiquitin OS=Pisum sativum GN=PU1 PE=3 SV=1)

HSP 1 Score: 95.5153 bits (236), Expect = 8.908e-20
Identity = 46/46 (100.00%), Postives = 46/46 (100.00%), Query Frame = 2
Query:   20 QDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 157
            QDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct:   31 QDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 76          
BLAST of CX296269 vs. ExPASy Swiss-Prot
Match: UBIQ_ORYSJ (Ubiquitin OS=Oryza sativa subsp. japonica GN=UBQ1 PE=3 SV=1)

HSP 1 Score: 95.5153 bits (236), Expect = 8.908e-20
Identity = 46/46 (100.00%), Postives = 46/46 (100.00%), Query Frame = 2
Query:   20 QDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 157
            QDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct:   31 QDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 76          
BLAST of CX296269 vs. ExPASy Swiss-Prot
Match: UBIQ_NICSY (Ubiquitin OS=Nicotiana sylvestris GN=UBICEP52-7 PE=3 SV=1)

HSP 1 Score: 95.5153 bits (236), Expect = 8.908e-20
Identity = 46/46 (100.00%), Postives = 46/46 (100.00%), Query Frame = 2
Query:   20 QDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 157
            QDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct:   31 QDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 76          
The following BLAST results are available for this feature:
BLAST of CX296269 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 81
Match NameE-valueIdentityDescription
UBL1_ORYSJ8.908e-20100.00Ubiquitin-like protein 1 OS=Oryza sativa subsp. ja... [more]
UBIQ_WHEAT8.908e-20100.00Ubiquitin OS=Triticum aestivum PE=3 SV=1[more]
UBIQ_TRYCR8.908e-20100.00Ubiquitin OS=Trypanosoma cruzi PE=3 SV=1[more]
UBIQ_SOYBN8.908e-20100.00Ubiquitin OS=Glycine max GN=SUBI-1 PE=3 SV=1[more]
UBIQ_SOLTU8.908e-20100.00Ubiquitin OS=Solanum tuberosum GN=UBI3 PE=3 SV=1[more]
UBIQ_SOLLC8.908e-20100.00Ubiquitin OS=Solanum lycopersicum GN=UBI3 PE=3 SV=... [more]
UBIQ_PETCR8.908e-20100.00Ubiquitin OS=Petroselinum crispum GN=PCUBI4-1 PE=3... [more]
UBIQ_PEA8.908e-20100.00Ubiquitin OS=Pisum sativum GN=PU1 PE=3 SV=1[more]
UBIQ_ORYSJ8.908e-20100.00Ubiquitin OS=Oryza sativa subsp. japonica GN=UBQ1 ... [more]
UBIQ_NICSY8.908e-20100.00Ubiquitin OS=Nicotiana sylvestris GN=UBICEP52-7 PE... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC05138B05SK FerrChloL1 Citrus clementina cDNA clone C05138B05, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CX296269 ID=CX296269|Name=CX296269|organism=Citrus clementina|type=EST|length=198bp
ATTCGGCCGAGGCCAAGACCAAGACAAGGAGGGAATCCCTCCCGACCAGC
AGAGGCTGATCTTCGCTGGAAAGCAACTCGAAGACGGCCGGACCTTGGCC
GATTACAACATCCAAAAAGAATCCACCTTGCATCTTGTCCTCAGGCTCCG
TGGTGGCATGCAGATCTTCGTCAAAACCCTAACTGGGAAGACGATCAC
back to top