CX296282

Overview
NameCX296282
Unique NameCX296282
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length473
Libraries
Library NameType
FerrChloL1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig1039 contig Ccv1_Contig1039:122..594. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CX296282 vs. ExPASy Swiss-Prot
Match: ARG2_PHAAU (Indole-3-acetic acid-induced protein ARG2 OS=Phaseolus aureus GN=ARG2 PE=2 SV=1)

HSP 1 Score: 94.7449 bits (234), Expect = 2.110e-19
Identity = 49/91 (53.85%), Postives = 59/91 (64.84%), Query Frame = -2
Query:  152 MARSFSNAKLFSALVADGISNAIYKRGYSAASQGAVSRATGGARSADAMLKNPAEEMTGSSEKVSWVPDPVTGVYRPENLVSELDGADLRA 424
            MARSF+N K+ SALVADG SN   + G++AA+    S   GGA     M+    EE     EKVSWVPDPVTG YRPEN  +E+D AD+RA
Sbjct:    1 MARSFTNVKVLSALVADGFSNTTTRHGFAAAAAATQSATRGGASIGGNMVPKSGEEKVRGGEKVSWVPDPVTGYYRPEN-TNEIDVADMRA 90          
BLAST of CX296282 vs. ExPASy Swiss-Prot
Match: LEA5_CITSI (Late embryogenesis abundant protein Lea5 OS=Citrus sinensis GN=LEA5 PE=2 SV=1)

HSP 1 Score: 74.3294 bits (181), Expect = 2.951e-13
Identity = 47/93 (50.54%), Postives = 59/93 (63.44%), Query Frame = -2
Query:  149 MARSFSNAKLFSALVADGISNAIYKRGYSAASQ-GAVSRATGGARSADAMLKNPAEEMTGSSEKVSWVPDPVTGVYRPENLVSELDGADLRAM 424
            MARS   AKL  A VADGIS +I +RGY+AA+  G +SR TG     D  L+    E +G+S   +W PDP+TG YRPEN   E+D A+LR M
Sbjct:    1 MARSLFKAKLLLAPVADGISLSISRRGYAAAAPLGTISR-TGIMEKND--LRPAVREDSGASS--AWAPDPITGYYRPENRAVEIDPAELREM 88          
BLAST of CX296282 vs. ExPASy Swiss-Prot
Match: LEA5D_GOSHI (Late embryogenesis abundant protein Lea5-D OS=Gossypium hirsutum GN=LEA5-D PE=2 SV=1)

HSP 1 Score: 73.1738 bits (178), Expect = 6.575e-13
Identity = 41/96 (42.71%), Postives = 57/96 (59.38%), Query Frame = -2
Query:  149 MARSFSNAKLFSALVADGISNAIYKRGYSAASQGAVSRATGGARSADAMLKNPAEEMTGSSE----KVSWVPDPVTGVYRPENLVSELDGADLRAM 424
            MARS S+ KL  A + DG+  +I +RGYS A   AV+ + G   +   + +  A + + SSE      +W PDPVTG YRPEN  +E+D A+LR M
Sbjct:    1 MARSVSSFKLLGASIFDGLYVSISRRGYSGAPPAAVTASFGRPGAMGKVERRDAMKESSSSETRAYSSAWAPDPVTGYYRPENCGAEIDAAELREM 96          
BLAST of CX296282 vs. ExPASy Swiss-Prot
Match: LEA5A_GOSHI (Late embryogenesis abundant protein Lea5-A OS=Gossypium hirsutum GN=LEA5-A PE=2 SV=1)

HSP 1 Score: 70.4774 bits (171), Expect = 4.262e-12
Identity = 41/96 (42.71%), Postives = 55/96 (57.29%), Query Frame = -2
Query:  149 MARSFSNAKLFSALVADGISNAIYKRGYSAASQGAVSRATGGARSADAMLKNPAEEMTGSSE----KVSWVPDPVTGVYRPENLVSELDGADLRAM 424
            MARS S+ K   A V D +  +I +RGYS A   AV+ + G   +   + +  A + + SSE      +W PDPVTG YRPEN  +E+D ADLR M
Sbjct:    1 MARSVSSFKFLGASVFDALYVSISRRGYSGAPPAAVTASFGRPGAMGKVERRYAMKESSSSETRAYSSAWAPDPVTGYYRPENCGAEIDAADLREM 96          
The following BLAST results are available for this feature:
BLAST of CX296282 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 4
Match NameE-valueIdentityDescription
ARG2_PHAAU2.110e-1953.85Indole-3-acetic acid-induced protein ARG2 OS=Phase... [more]
LEA5_CITSI2.951e-1350.54Late embryogenesis abundant protein Lea5 OS=Citrus... [more]
LEA5D_GOSHI6.575e-1342.71Late embryogenesis abundant protein Lea5-D OS=Goss... [more]
LEA5A_GOSHI4.262e-1242.71Late embryogenesis abundant protein Lea5-A OS=Goss... [more]
back to top
Properties
Property NameValue
Genbank descriptionC05138C11SK FerrChloL1 Citrus clementina cDNA clone C05138C11, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CX296282 ID=CX296282|Name=CX296282|organism=Citrus clementina|type=EST|length=473bp
AGCTCATGCGGCTGACCACATCAGAACACATCCCTTTTTAACCTTTTTTT
AATTTTTCTTTCGTCCTTCCTCAGTTTCCATGTCCGAATTAATATATATT
AATAATAATACTTATTAATTTTGATGATCAGTTGCTGTGCTTCAAGAACA
TGGCTCTGAGGTCGGCCCCATCGAGCTCGCTGACGAGATTCTCCGGCCTG
TAGACACCAGTGACTGGGTCTGGGACCCACGAGACCTTCTCACTGGATCC
TGTCATCTCTTCTGCTGGGTTCTTCAACATCGCATCAGCACTCCTAGCTC
CCCCTGTTGCCCGCGACACAGCGCCTTGTGATGCCGCCGAGTATCCTCTT
TTGTAGATGGCGTTAGAGATTCCGTCAGCGACGAGAGCAGAGAATAGCTT
AGCGTTTGAGAAAGAGCGAGCCATTTCCTCGTGCCGAATTCGGCACGAGG
CGGCACGAGGGGGGGGGCCCGGT
back to top