CX296327

Overview
NameCX296327
Unique NameCX296327
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length702
Libraries
Library NameType
FerrChloL1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig9479 contig Ccv1_Contig9479:22..724. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CX296327 vs. ExPASy Swiss-Prot
Match: RD22_ARATH (Dehydration-responsive protein RD22 OS=Arabidopsis thaliana GN=RD22 PE=2 SV=1)

HSP 1 Score: 135.961 bits (341), Expect = 1.950e-31
Identity = 90/231 (38.96%), Postives = 112/231 (48.48%), Query Frame = 1
Query:  100 VASHADISPELYWKTVLPNSPMPKAVKDLLQPDVLEDKSTSVNVGKGGVN----------------------VDAGKXXXXXXXXXXXXXXXXXXXXXXXD-----KRXXXXXXXXXXXXXXXXXXXPVYVGV----SPFNYVYAANENQLHDDPNTALFFLEKDLHPGMKMNLHFTQTS--NGAT-FLSRQAAKSTPFSSDKLPEIFNQFSVKPGSVEAEIMQNTNQECE 690
            VA  AD++PE YW T LPN+P+P ++ +LL  D  ++KST+V VGKGGVN                      VD GK                             KR                   P+YVGV    +PF Y YAA E QLHDDPN ALFFLEKDL  G +MN+ F       G T FL R  A++ PF S+K  E   +FSV+ GS EAE+M+ T +ECE
Sbjct:   17 VAIAADLTPERYWSTALPNTPIPNSLHNLLTFDFTDEKSTNVQVGKGGVNVNTHKGKTGSGTAVNVGKGGVRVDTGKGKPGGGTHVSVGSGKGHGGGVAVHTGKPGKRTDVGVGKGGVTVHTRHKGRPIYVGVKPGANPFVYNYAAKETQLHDDPNAALFFLEKDLVRGKEMNVRFNAEDGYGGKTAFLPRGEAETVPFGSEKFSETLKRFSVEAGSEEAEMMKKTIEECE 247          
BLAST of CX296327 vs. ExPASy Swiss-Prot
Match: BURP3_ORYSJ (BURP domain-containing protein 3 OS=Oryza sativa subsp. japonica GN=BURP3 PE=2 SV=1)

HSP 1 Score: 130.568 bits (327), Expect = 8.192e-30
Identity = 63/99 (63.64%), Postives = 74/99 (74.75%), Query Frame = 1
Query:  400 PVYVGVSPFNYVYAANENQLHDDPNTALFFLEKDLHPGMKMNLHFTQTSNGATFLSRQAAKSTPFSSDKLPEIFNQFSVKPGSVEAEIMQNTNQECEDP 696
            PV+V V+PF Y YAA E QLHDDPN ALFFLEKDLHPG  M +HFT T+ G  FL R  A + PFSS+K+PEI ++FSVKPGSVEA  M  T ++CE P
Sbjct:  185 PVHVNVAPFIYNYAATETQLHDDPNVALFFLEKDLHPGKTMAVHFTATTAGEKFLPRSEADAMPFSSEKVPEILSRFSVKPGSVEAAEMAQTLRDCEAP 283          
BLAST of CX296327 vs. ExPASy Swiss-Prot
Match: BURP6_ORYSJ (BURP domain-containing protein 6 OS=Oryza sativa subsp. japonica GN=BURP6 PE=2 SV=1)

HSP 1 Score: 82.0333 bits (201), Expect = 3.341e-15
Identity = 41/76 (53.95%), Postives = 51/76 (67.11%), Query Frame = 1
Query:  463 DDPNTALFFLEKDLHPGMKMNLHFTQTSNGATFLSRQAAKSTPFSSDKLPEIFNQFSVKPGSVEAEIMQNTNQECE 690
            +D    +FFLEKDL PG KM LHFT+ + GA  L R  A S PF+S+KLPEI +Q SV  GS  A+ M++T  ECE
Sbjct:   21 EDTVNNVFFLEKDLFPGSKMTLHFTRATAGAALLPRGRADSVPFASEKLPEILSQLSVPAGSPAADAMRSTLAECE 96          
BLAST of CX296327 vs. ExPASy Swiss-Prot
Match: BURP2_ORYSJ (BURP domain-containing protein 2 OS=Oryza sativa subsp. japonica GN=BURP2 PE=2 SV=1)

HSP 1 Score: 81.2629 bits (199), Expect = 5.699e-15
Identity = 41/84 (48.81%), Postives = 56/84 (66.67%), Query Frame = 1
Query:  439 AANENQLHDDPNTALFFLEKDLHPGMKMNLHFTQTSNGATFLSRQAAKSTPFSSDKLPEIFNQFSVKPGSVEAEIMQNTNQECE 690
            AA+ ++  +D   ++FFLEKDL PG KM LHFT+ + GA  L R  A S PF+S+KLPEI +Q S+  GS  A+ M++T   CE
Sbjct:   52 AASASKDKEDTVGSVFFLEKDLFPGSKMTLHFTRATAGAALLPRGRADSVPFASEKLPEILSQLSIPAGSPTADAMRSTLAVCE 135          
BLAST of CX296327 vs. ExPASy Swiss-Prot
Match: BURP1_ORYSJ (BURP domain-containing protein 1 OS=Oryza sativa subsp. japonica GN=BURP1 PE=2 SV=1)

HSP 1 Score: 77.411 bits (189), Expect = 8.230e-14
Identity = 42/92 (45.65%), Postives = 59/92 (64.13%), Query Frame = 1
Query:  415 VSPFNYVYAANENQLHDDPNTALFFLEKDLHPGMKMNLHFTQTSNGATFLSRQAAKSTPFSSDKLPEIFNQFSVKPGSVEAEIMQNTNQECE 690
            +SP + V +A++    +D    +FFLEKDL PG KM LHFT+ + GA  L R  A+S PF+S++LPEI +Q S+   S  A+ M +T  ECE
Sbjct:   46 ISPASSVGSASK----EDTVGNVFFLEKDLFPGSKMTLHFTRATAGAALLPRGRAESVPFASERLPEILSQLSIPAVSPTADAMWSTLAECE 133          
BLAST of CX296327 vs. ExPASy Swiss-Prot
Match: BURP5_ORYSJ (BURP domain-containing protein 5 OS=Oryza sativa subsp. japonica GN=BURP5 PE=2 SV=2)

HSP 1 Score: 75.8702 bits (185), Expect = 2.395e-13
Identity = 42/98 (42.86%), Postives = 54/98 (55.10%), Query Frame = 1
Query:  403 VYVGVSPFNYVYAANENQLHDDPNTALFFLEKDLHPGMKMNLHFTQTSNGATFLSRQAAKSTPFSSDKLPEIFNQFSVKPGSVEAEIMQNTNQECEDP 696
            V +   P  Y  AA++ Q   DP   LFFLE +L     + LHF     G  FL R  A + PFSS  L EI  +F V+PGSV+A +++NT  ECE P
Sbjct:   83 VQIRYGPNIYGLAASQ-QFFKDPTMGLFFLETNLQSSKSIKLHFANMMAGTKFLPRGEADAVPFSSKDLQEILARFGVRPGSVDASVVKNTLLECELP 179          
BLAST of CX296327 vs. ExPASy Swiss-Prot
Match: BURP8_ORYSJ (BURP domain-containing protein 8 OS=Oryza sativa subsp. japonica GN=BURP8 PE=2 SV=2)

HSP 1 Score: 74.7146 bits (182), Expect = 5.335e-13
Identity = 43/85 (50.59%), Postives = 54/85 (63.53%), Query Frame = 1
Query:  439 AANENQLHDDPNT-ALFFLEKDLHPGMKMNLHFTQTSNGATFLSRQAAKSTPFSSDKLPEIFNQFSVKPGSVEAEIMQNTNQECE 690
            A+ E+   D+ +T A+FFLEKDL PG K+ LHFT+    A  L R  A + PF+S+KLPEI  Q SV  GS  AE M+ T  ECE
Sbjct:   82 ASQEDTDMDEVSTDAVFFLEKDLFPGSKITLHFTRGGACAMVLLRGRADAIPFASEKLPEILTQLSVPAGSRAAEDMRTTLAECE 166          
BLAST of CX296327 vs. ExPASy Swiss-Prot
Match: BURPH_ORYSJ (BURP domain-containing protein 17 OS=Oryza sativa subsp. japonica GN=BURP17 PE=2 SV=1)

HSP 1 Score: 73.9442 bits (180), Expect = 9.099e-13
Identity = 42/85 (49.41%), Postives = 54/85 (63.53%), Query Frame = 1
Query:  454 QLHDDPNTALFFLEKDLHPGMKMN--LHFTQ--TSNGATFLSRQAAKSTPFSSDKLPEIFNQFSVKPGSVEAEIMQNTNQECEDP 696
            +L  DP+ ALFFLEK+L  G K+N  LHF     +  + FL R  A S PFSS +LPEI ++F V+PGS +A  M  T Q+CE P
Sbjct:  353 ELLKDPDMALFFLEKNLQQGKKINNALHFANLLATTNSKFLPRGKADSIPFSSKELPEILDRFGVRPGSDDAAEMSATLQDCELP 437          
BLAST of CX296327 vs. ExPASy Swiss-Prot
Match: BURP7_ORYSJ (BURP domain-containing protein 7 OS=Oryza sativa subsp. japonica GN=BURP7 PE=2 SV=1)

HSP 1 Score: 68.1662 bits (165), Expect = 4.993e-11
Identity = 33/62 (53.23%), Postives = 42/62 (67.74%), Query Frame = 1
Query:  481 LFFLEKDLHPGMKMNLHFTQTSNGATFLSRQAAKSTPFSSDKLPEIFNQFSVKPGSVEAEIM 666
            +FFLEKDL PG K+ LHFT+ + GA  L R  A S P +++KLPEI +Q SV  GS  A+ M
Sbjct:   64 VFFLEKDLFPGSKLTLHFTRATAGAALLPRGRADSVPLATEKLPEILSQLSVPAGSPAADAM 125          
The following BLAST results are available for this feature:
BLAST of CX296327 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 9
Match NameE-valueIdentityDescription
RD22_ARATH1.950e-3138.96Dehydration-responsive protein RD22 OS=Arabidopsis... [more]
BURP3_ORYSJ8.192e-3063.64BURP domain-containing protein 3 OS=Oryza sativa s... [more]
BURP6_ORYSJ3.341e-1553.95BURP domain-containing protein 6 OS=Oryza sativa s... [more]
BURP2_ORYSJ5.699e-1548.81BURP domain-containing protein 2 OS=Oryza sativa s... [more]
BURP1_ORYSJ8.230e-1445.65BURP domain-containing protein 1 OS=Oryza sativa s... [more]
BURP5_ORYSJ2.395e-1342.86BURP domain-containing protein 5 OS=Oryza sativa s... [more]
BURP8_ORYSJ5.335e-1350.59BURP domain-containing protein 8 OS=Oryza sativa s... [more]
BURPH_ORYSJ9.099e-1349.41BURP domain-containing protein 17 OS=Oryza sativa ... [more]
BURP7_ORYSJ4.993e-1153.23BURP domain-containing protein 7 OS=Oryza sativa s... [more]
back to top
Properties
Property NameValue
Genbank descriptionC05138H09SK FerrChloL1 Citrus clementina cDNA clone C05138H09, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CX296327 ID=CX296327|Name=CX296327|organism=Citrus clementina|type=EST|length=702bp
CGAGGATCTATCTTGTATTCTGGGTGTCTTTTAAACATACTCAAAGCTAT
AATGGAGTTTCACTTGTTGCCCATCCTTGCTTTCCTCAGTCTAGCACTGG
TAGCAAGTCATGCTGACATTTCTCCTGAGCTTTACTGGAAAACTGTACTG
CCAAATTCCCCGATGCCAAAAGCTGTCAAAGATCTTCTACAGCCAGATGT
GCTGGAAGACAAAAGCACCTCTGTCAACGTAGGGAAGGGTGGTGTCAATG
TGGATGCAGGGAAAGGAAAGCCCGGTGGTGGCACCCATGTGAATGTTGGG
GGTAAGGGCGTTGGTGTAAACACTGGAAAGCCTGACAAAAGAACCAGTGT
TGGTGTTGGCAAAGGAGGAGTATCCGTAAGTACAGGACACAAGGGAAAGC
CAGTTTATGTTGGAGTAAGCCCATTCAACTATGTATATGCTGCAAATGAG
AACCAACTCCATGATGACCCGAATACAGCTCTTTTCTTCTTGGAAAAGGA
CTTGCATCCTGGCATGAAGATGAACTTGCACTTCACTCAAACTTCAAATG
GAGCAACTTTCTTATCTCGCCAAGCTGCCAAATCAACTCCTTTCTCGTCT
GACAAATTGCCTGAGATCTTTAACCAGTTTTCCGTGAAACCTGGATCAGT
TGAAGCTGAAATAATGCAGAACACAAATCAAGAGTGTGAAGACCCTGGCA
TT
back to top