CX296333

Overview
NameCX296333
Unique NameCX296333
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length654
Libraries
Library NameType
FerrChloL1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of CX296333 vs. ExPASy Swiss-Prot
Match: WRK15_ARATH (Probable WRKY transcription factor 15 OS=Arabidopsis thaliana GN=WRKY15 PE=1 SV=1)

HSP 1 Score: 161.384 bits (407), Expect = 3.776e-39
Identity = 73/95 (76.84%), Postives = 84/95 (88.42%), Query Frame = -2
Query:  384 KRVVRVPAVSLRLSDIPPDDFSWRKYGQKPIKGSPHPRGYYKCSSVRGCPARKHVERALDDPSMLVVTYEGEHNHSLSVAD-----TRNLILESS 653
            +R++RVPA+S ++SD+PPDD+SWRKYGQKPIKGSPHPRGYYKCSSVRGCPARKHVERA DD SML+VTYEG+HNHSLS AD       +LILESS
Sbjct:  223 RRIIRVPAISAKMSDVPPDDYSWRKYGQKPIKGSPHPRGYYKCSSVRGCPARKHVERAADDSSMLIVTYEGDHNHSLSAADLAGAAVADLILESS 317          
BLAST of CX296333 vs. ExPASy Swiss-Prot
Match: WRKY7_ARATH (Probable WRKY transcription factor 7 OS=Arabidopsis thaliana GN=WRKY7 PE=1 SV=1)

HSP 1 Score: 149.443 bits (376), Expect = 1.485e-35
Identity = 66/82 (80.49%), Postives = 75/82 (91.46%), Query Frame = -2
Query:  408 KRVVRVPAVSLRLSDIPPDDFSWRKYGQKPIKGSPHPRGYYKCSSVRGCPARKHVERALDDPSMLVVTYEGEHNHSLSVADT 653
            KRV+RVPAVS +++DIP D+FSWRKYGQKPIKGSPHPRGYYKCSSVRGCPARKHVERALDD  ML+VTYEG+HNH+L +  T
Sbjct:  264 KRVIRVPAVSSKMADIPSDEFSWRKYGQKPIKGSPHPRGYYKCSSVRGCPARKHVERALDDAMMLIVTYEGDHNHALVLETT 345          
BLAST of CX296333 vs. ExPASy Swiss-Prot
Match: WRK11_ARATH (Probable WRKY transcription factor 11 OS=Arabidopsis thaliana GN=WRKY11 PE=1 SV=2)

HSP 1 Score: 148.288 bits (373), Expect = 3.308e-35
Identity = 63/78 (80.77%), Postives = 73/78 (93.59%), Query Frame = -2
Query:  420 KRVVRVPAVSLRLSDIPPDDFSWRKYGQKPIKGSPHPRGYYKCSSVRGCPARKHVERALDDPSMLVVTYEGEHNHSLS 653
            KR VRVPA+S +++DIPPD++SWRKYGQKPIKGSPHPRGYYKCS+ RGCPARKHVERALDDP+ML+VTYEGEH H+ S
Sbjct:  229 KRTVRVPAISAKIADIPPDEYSWRKYGQKPIKGSPHPRGYYKCSTFRGCPARKHVERALDDPAMLIVTYEGEHRHNQS 306          
BLAST of CX296333 vs. ExPASy Swiss-Prot
Match: WRK39_ARATH (Probable WRKY transcription factor 39 OS=Arabidopsis thaliana GN=WRKY39 PE=1 SV=1)

HSP 1 Score: 145.206 bits (365), Expect = 2.801e-34
Identity = 61/76 (80.26%), Postives = 72/76 (94.74%), Query Frame = -2
Query:  426 KRVVRVPAVSLRLSDIPPDDFSWRKYGQKPIKGSPHPRGYYKCSSVRGCPARKHVERALDDPSMLVVTYEGEHNHS 653
            KR ++VPA+S +++DIPPD++SWRKYGQKPIKGSPHPRGYYKCSSVRGCPARKHVER +D+ SML+VTYEGEHNHS
Sbjct:  245 KRSIKVPAISNKIADIPPDEYSWRKYGQKPIKGSPHPRGYYKCSSVRGCPARKHVERCIDETSMLIVTYEGEHNHS 320          
BLAST of CX296333 vs. ExPASy Swiss-Prot
Match: WRK17_ARATH (Probable WRKY transcription factor 17 OS=Arabidopsis thaliana GN=WRKY17 PE=1 SV=2)

HSP 1 Score: 144.821 bits (364), Expect = 3.658e-34
Identity = 63/78 (80.77%), Postives = 71/78 (91.03%), Query Frame = -2
Query:  420 KRVVRVPAVSLRLSDIPPDDFSWRKYGQKPIKGSPHPRGYYKCSSVRGCPARKHVERALDDPSMLVVTYEGEHNHSLS 653
            KR VRVPAVS +++DIPPD++SWRKYGQKPIKGSPHPRGYYKCS+ RGCPARKHVERALDD +ML+VTYEGEH H  S
Sbjct:  226 KRTVRVPAVSAKIADIPPDEYSWRKYGQKPIKGSPHPRGYYKCSTFRGCPARKHVERALDDSTMLIVTYEGEHRHHQS 303          
BLAST of CX296333 vs. ExPASy Swiss-Prot
Match: WRKY1_MAIZE (Protein WRKY1 OS=Zea mays PE=1 SV=1)

HSP 1 Score: 144.05 bits (362), Expect = 6.239e-34
Identity = 61/80 (76.25%), Postives = 74/80 (92.50%), Query Frame = -2
Query:  414 KRVVRVPAVSLRLSDIPPDDFSWRKYGQKPIKGSPHPRGYYKCSSVRGCPARKHVERALDDPSMLVVTYEGEHNHSLSVA 653
            +R ++VPA+S +++DIP D+FSWRKYGQKPIKGSPHPRGYYKCSSVRGCPARKHVER +DDPSML+VTYEG+HNH+  +A
Sbjct:  315 RRSIKVPAISNKVADIPADEFSWRKYGQKPIKGSPHPRGYYKCSSVRGCPARKHVERCVDDPSMLIVTYEGDHNHNRVLA 394          
BLAST of CX296333 vs. ExPASy Swiss-Prot
Match: WRK74_ARATH (Probable WRKY transcription factor 74 OS=Arabidopsis thaliana GN=WRKY74 PE=1 SV=1)

HSP 1 Score: 143.28 bits (360), Expect = 1.064e-33
Identity = 60/76 (78.95%), Postives = 72/76 (94.74%), Query Frame = -2
Query:  426 KRVVRVPAVSLRLSDIPPDDFSWRKYGQKPIKGSPHPRGYYKCSSVRGCPARKHVERALDDPSMLVVTYEGEHNHS 653
            KR ++VPA+S +++DIPPD++SWRKYGQKPIKGSPHPRGYYKCSSVRGCPARKHVER +++ SML+VTYEGEHNHS
Sbjct:  245 KRSIKVPAISNKIADIPPDEYSWRKYGQKPIKGSPHPRGYYKCSSVRGCPARKHVERCVEETSMLIVTYEGEHNHS 320          
BLAST of CX296333 vs. ExPASy Swiss-Prot
Match: WRK21_ARATH (Probable WRKY transcription factor 21 OS=Arabidopsis thaliana GN=WRKY21 PE=1 SV=1)

HSP 1 Score: 141.739 bits (356), Expect = 3.096e-33
Identity = 59/75 (78.67%), Postives = 71/75 (94.67%), Query Frame = -2
Query:  429 KRVVRVPAVSLRLSDIPPDDFSWRKYGQKPIKGSPHPRGYYKCSSVRGCPARKHVERALDDPSMLVVTYEGEHNH 653
            +R +RVPA+S +++DIPPDD+SWRKYGQKPIKGSP+PRGYYKCSS+RGCPARKHVER L+DP+ML+VTYE EHNH
Sbjct:  296 RRSIRVPAISNKVADIPPDDYSWRKYGQKPIKGSPYPRGYYKCSSMRGCPARKHVERCLEDPAMLIVTYEAEHNH 370          
BLAST of CX296333 vs. ExPASy Swiss-Prot
Match: WRK65_ARATH (Probable WRKY transcription factor 65 OS=Arabidopsis thaliana GN=WRKY65 PE=2 SV=1)

HSP 1 Score: 109.768 bits (273), Expect = 1.304e-23
Identity = 52/91 (57.14%), Postives = 65/91 (71.43%), Query Frame = -2
Query:  402 KRVVRVPAVSLRLS------DIPPDDFSWRKYGQKPIKGSPHPRGYYKCSSVRGCPARKHVERALDDPSMLVVTYEGEHNHSLSV-ADTRN 653
            KRVV VP   +  S        P D ++WRKYGQKPIKGSP+PRGYY+CSS +GCPARK VER+ DDP+M+++TY  EHNH   + + TRN
Sbjct:   51 KRVVNVPMKEMEGSRHKGDTTPPSDSWAWRKYGQKPIKGSPYPRGYYRCSSTKGCPARKQVERSRDDPTMILITYTSEHNHPWPLTSSTRN 141          
BLAST of CX296333 vs. ExPASy Swiss-Prot
Match: WRK35_ARATH (Probable WRKY transcription factor 35 OS=Arabidopsis thaliana GN=WRKY35 PE=2 SV=1)

HSP 1 Score: 103.605 bits (257), Expect = 9.345e-22
Identity = 48/80 (60.00%), Postives = 60/80 (75.00%), Query Frame = -2
Query:  429 KRVVRVPAVSLRLSD-----IPPDDFSWRKYGQKPIKGSPHPRGYYKCSSVRGCPARKHVERALDDPSMLVVTYEGEHNH 653
            K+VV +PA +   S      +P D ++WRKYGQKPIKGSP+PRGYY+CSS +GC ARK VER+  DP+MLV+TY  EHNH
Sbjct:  193 KKVVCIPAPAAMNSRSSGEVVPSDLWAWRKYGQKPIKGSPYPRGYYRCSSSKGCSARKQVERSRTDPNMLVITYTSEHNH 272          
The following BLAST results are available for this feature:
BLAST of CX296333 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 60
Match NameE-valueIdentityDescription
WRK15_ARATH3.776e-3976.84Probable WRKY transcription factor 15 OS=Arabidops... [more]
WRKY7_ARATH1.485e-3580.49Probable WRKY transcription factor 7 OS=Arabidopsi... [more]
WRK11_ARATH3.308e-3580.77Probable WRKY transcription factor 11 OS=Arabidops... [more]
WRK39_ARATH2.801e-3480.26Probable WRKY transcription factor 39 OS=Arabidops... [more]
WRK17_ARATH3.658e-3480.77Probable WRKY transcription factor 17 OS=Arabidops... [more]
WRKY1_MAIZE6.239e-3476.25Protein WRKY1 OS=Zea mays PE=1 SV=1[more]
WRK74_ARATH1.064e-3378.95Probable WRKY transcription factor 74 OS=Arabidops... [more]
WRK21_ARATH3.096e-3378.67Probable WRKY transcription factor 21 OS=Arabidops... [more]
WRK65_ARATH1.304e-2357.14Probable WRKY transcription factor 65 OS=Arabidops... [more]
WRK35_ARATH9.345e-2260.00Probable WRKY transcription factor 35 OS=Arabidops... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC05139A05SK FerrChloL1 Citrus clementina cDNA clone C05139A05, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CX296333 ID=CX296333|Name=CX296333|organism=Citrus clementina|type=EST|length=654bp
GGTTAAGCTAAGTAATGAGGTGCTGCGCTTTTATTCAATCCTGGGAAACA
TAAGAACAAATCCAACATCTTCCCTAGCTTTTAGTTTCTAATTAACATTG
GAACACACAGTGCTTGGGTATAGAGACAGGTAGAGCTATACCAAGAGGAA
TCCCATATTATACAGACAGGGGAATGAACAAAATGAACCCAGAAATCTCC
TTCGAGACAGACAATTCCAAGCTGGGCTTCTGCTGAATTCTTAACTTTAA
AGCAAAAGCTAGCCAGCCAGACAGTTCCCTAGTTCTGTTAAATATAATAT
ATAATATTGCCACCACCGCTATGTAATTCCCCCCCTAACCAATGATCTAA
TTTCTCACGACTGGTTTTTTTGTTGCGTGTCTAAGAAGATTCCAGGATGA
GATTTCTAGTATCTGCAACAGAGAGTGAGTGATTGTGCTCGCCTTCGTAG
GTGACTACAAGCATCGATGGATCATCCAACGCTCTCTCCACGTGCTTGCG
TGCAGGGCAGCCTCTCACACTGCTGCACTTGTAGTAACCCCTCGGATGAG
GAGATCCTTTGATGGGTTTCTGTCCATACTTCCTCCACGAGAAATCATCA
GGTGGAATATCAGACAACCTTAAGCTTACAGCCGGAACCCTAACAACTCT
CTTC
back to top