CX296338

Overview
NameCX296338
Unique NameCX296338
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length711
Libraries
Library NameType
FerrChloL1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig10437 contig Ccv1_Contig10437:286..996. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CX296338 vs. ExPASy Swiss-Prot
Match: WRKY6_ARATH (WRKY transcription factor 6 OS=Arabidopsis thaliana GN=WRKY6 PE=1 SV=1)

HSP 1 Score: 89.3521 bits (220), Expect = 2.127e-17
Identity = 60/141 (42.55%), Postives = 69/141 (48.94%), Query Frame = -3
Query:  287 MDNEPQLLARAIFPCSSSMATISASAPFPTVTLDLTHSPNP---------XXXXXXXXXXXXXFPGQPQNLASVTNTQLPQVFGQALYNQSKFSGXXXXXXXXXXXXXXSHQTXXXXXXXXXXLADTVSAATAAITADPNF 682
            M N   LLARA+ PCS+SMATISASAPFPTVTLDLTHSP P                         Q Q + ++    LP V GQALYNQSKFSG                            +ADT++    A+TADPNF
Sbjct:  400 MMNPTNLLARAVLPCSTSMATISASAPFPTVTLDLTHSPPPPNGSNPSSSAATNNNHNSLMQRPQQQQQQMTNLPPGMLPHVIGQALYNQSKFSGLQFSGGSPSTAAFSQSHA----------VADTIT----ALTADPNF 526          
BLAST of CX296338 vs. ExPASy Swiss-Prot
Match: WRK31_ARATH (Probable WRKY transcription factor 31 OS=Arabidopsis thaliana GN=WRKY31 PE=2 SV=1)

HSP 1 Score: 88.9669 bits (219), Expect = 2.779e-17
Identity = 62/133 (46.62%), Postives = 72/133 (54.14%), Query Frame = -3
Query:  287 NEPQLLARAIFPCSSSMATISASAPFPTVTLDLTHSPNPXXXXXXXXXXXXXFPGQPQNLASVTNTQLPQVFGQALYN---QSKFSGXXXXXXXXXXXXXXSHQTXXXXXXXXXXLADTVSAATAAITADPNF 676
            N   LLARAI PCSSSMATISASAPFPT+TLDLT+SPN              F  +P    +V    LPQV GQA+YN   QSKFSG                            +A++VSAA+AAI +DPNF
Sbjct:  387 NPTNLLARAILPCSSSMATISASAPFPTITLDLTNSPNGNNPNMTTNNPLMQFAQRPGFNPAV----LPQVVGQAMYNNQQQSKFSGLQL-------------PAQPLQIAATSSVAESVSAASAAIASDPNF 502          
BLAST of CX296338 vs. ExPASy Swiss-Prot
Match: WRK42_ARATH (Probable WRKY transcription factor 42 OS=Arabidopsis thaliana GN=WRKY42 PE=2 SV=1)

HSP 1 Score: 84.3445 bits (207), Expect = 6.844e-16
Identity = 57/132 (43.18%), Postives = 65/132 (49.24%), Query Frame = -3
Query:  287 NEPQLLARAIFPCSSSMATISASAPFPTVTLDLTHSPNPXXXXXXXXXXXXXFPGQPQNLASVTNTQLPQVFGQALY--NQSKFSGXXXXXXXXXXXXXXSHQTXXXXXXXXXXLADTVSAATAAITADPNF 676
            N   LLAR I PCSSSMATISASAPFPT+TLDLT SPN                 Q   L  +  + LP + GQALY   QSKFSG                              ++VSAATAAI ++PNF
Sbjct:  383 NPTNLLARTILPCSSSMATISASAPFPTITLDLTESPNGNNPTNNPLMQF----SQRSGLVELNQSVLPHMMGQALYYNQQSKFSG-------------------LHMPSQPLNAGESVSAATAAIASNPNF 491          
The following BLAST results are available for this feature:
BLAST of CX296338 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 3
Match NameE-valueIdentityDescription
WRKY6_ARATH2.127e-1742.55WRKY transcription factor 6 OS=Arabidopsis thalian... [more]
WRK31_ARATH2.779e-1746.62Probable WRKY transcription factor 31 OS=Arabidops... [more]
WRK42_ARATH6.844e-1643.18Probable WRKY transcription factor 42 OS=Arabidops... [more]
back to top
Properties
Property NameValue
Genbank descriptionC05139A11SK FerrChloL1 Citrus clementina cDNA clone C05139A11, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CX296338 ID=CX296338|Name=CX296338|organism=Citrus clementina|type=EST|length=711bp
AAAAATAAGAATGAATGGAACATTTTTTTTTGTGTTCTAATTACCCTCCC
CCACAACAAAGGATAAAGAAAAGAAAATATGAACATGTTTGCATCCCCTA
AAAATAAAAGAACTAATAACATGAAAACATTGATTAAAAGTGAAAAAGAA
AGAGCTGGCCCATCTCTAATTTGATGAGAAGCTGTAAAGTTTATTGGTGT
TGCCTGTTGTTATTATTGGAGTTGTTGCTAAAAGGATTTTGTGCACCGCC
AATAATGGAAGTGATGGCGGCGGCAAGAGCTGCAGTGAAGTTTGGATCAG
CTGTGATGGCGGCCGTGGCGGCACTTACAGTGTCAGCCAACTGCTGCGGT
TGTTGCAATGGTGGAGGTAGAGTTTGATGGCTACCCGATTGAGAATTAGA
CCCAATATTTTGAGATAATTGTAGACCTGAGAATTTTGATTGATTGTAAA
GGGCCTGACCAAAAACTTGAGGCAATTGAGTGTTTGTGACAGAGGCAAGA
TTTTGTGGCTGGCCTGGAAATTGGACTTGGAATTGAGCTGCTTGCCTTTG
GAGTTGTAAAGGGTTTGGTGAATGAGTAAGGTCTAATGTAACTGTAGGAA
ATGGGGCAGAAGCTGAAATCGTAGCCATGCTTGATGAGCAAGGAAAGATA
GCTCTGGCTAGCAATTGGGGTTCATTATCCATCTGCACTCGACATTGATC
TGAAGTACATG
back to top