CX296515

Overview
NameCX296515
Unique NameCX296515
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length645
Libraries
Library NameType
FerrChloL1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
CX296515_ssr166 microsatellite CX296515_ssr166:166..180. BLAST: Citrus ESTs to Prunus persica proteins V1
Ccv1_Contig696 contig Ccv1_Contig696:87..730. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CX296515 vs. ExPASy Swiss-Prot
Match: ELI_PEA (Early light-induced protein, chloroplastic OS=Pisum sativum PE=2 SV=1)

HSP 1 Score: 203.371 bits (516), Expect = 8.418e-52
Identity = 113/177 (63.84%), Postives = 132/177 (74.58%), Query Frame = 3
Query:   75 RSGANQLSSVK--YLPSLRRNVNLSVRCTAXXXXXXXXXXXX-PTIPKAE---PQPP--KKPRMSTGFSEVFAFSGPAPERINGRLAMIGFVAALGVEISKGQDVFAQLSDGGVAWFLGTSVLLTVASLVPLFKGVSVESKSDGFMTSDAELWNGRFAMLGLVALAFTEFVKGGTLV 581
            RS  NQ +++   Y+P+LRRNV+L VR  A             PT P A    PQP   + P+MST FS++ AFSGPAPERINGRLAMIGFVAA+GVEI+KGQ +  QLS GGVAWFLGTSVLL++ASL+P F+GVSVESKS   M+SDAE WNGR AMLGLVALAFTEFVKG +LV
Sbjct:   20 RSRVNQFTNIPSVYIPTLRRNVSLKVRSMAEGEPKEQSKVAVDPTTPTASTPTPQPAYTRPPKMSTKFSDLMAFSGPAPERINGRLAMIGFVAAMGVEIAKGQGLSEQLSGGGVAWFLGTSVLLSLASLIPFFQGVSVESKSKSIMSSDAEFWNGRIAMLGLVALAFTEFVKGTSLV 196          
BLAST of CX296515 vs. ExPASy Swiss-Prot
Match: DS22_CRAPL (Desiccation stress protein DSP-22, chloroplastic OS=Craterostigma plantagineum GN=DSP-22 PE=2 SV=1)

HSP 1 Score: 155.606 bits (392), Expect = 2.013e-37
Identity = 86/177 (48.59%), Postives = 117/177 (66.10%), Query Frame = 3
Query:   69 IRRSGANQLSSVKY---LPSLRRNVNLSVRCTAXXXXXXXXXXXXP--TIPKAEPQPPKKPRMSTGFS-EVFAFSGPAPERINGRLAMIGFVAALGVEISKGQDVFAQLSDGGVAWFLGTSVLLTVASLVPLFKGVSVESKSDGFMTSDAELWNGRFAMLGLVALAFTEFVKGGTLV 581
            I R G N L   K    LP +RRN   +VR                  T        P +  ++T  + ++F+F G APERINGR AMIGFVAA+GVE++ G+DVF+Q+ +GGV WFL TS +L +A+L+P+++G+S E+K++GF  SDAE+WNGRFAM+GLVALAFTE+VKGG L+
Sbjct:   21 ITRFGPNNLFLGKQSYELPLMRRNAKFTVRSMREDNEKEEQQQQKQQQTHDGGPDLTPNRTEVTTKRTVDLFSFDGLAPERINGRSAMIGFVAAVGVELATGRDVFSQVFNGGVMWFLLTSAVLVLATLIPIYRGLSPEAKNNGFWNSDAEIWNGRFAMIGLVALAFTEYVKGGPLI 197          
BLAST of CX296515 vs. ExPASy Swiss-Prot
Match: ELI5_HORVU (High molecular mass early light-inducible protein HV58, chloroplastic OS=Hordeum vulgare PE=2 SV=1)

HSP 1 Score: 140.584 bits (353), Expect = 6.701e-33
Identity = 75/131 (57.25%), Postives = 93/131 (70.99%), Query Frame = 3
Query:  195 PTIPKAEPQPPKKPRMSTGFSEVFAFSGPAPERINGRLAMIGFVAALGVEISKGQDVFAQLS--DGGVAWFLGTSVLLTVASLVPLFKGVSVESKSDGFMTSDAELWNGRFAMLGLVALAFTEFVKGGTLV 581
            PT   A P+P  K + +    +  AFSGPAPERINGRLAM+GFVAAL VE ++G  +  Q+     G+AWFL T+ + +VASL+PL +G SVESKS G  ++DAELWNGRFAMLGLVALA TEF+ G   V
Sbjct:  100 PTTIPAAPKPVTK-KANPSVWDALAFSGPAPERINGRLAMVGFVAALSVEAARGGGLLDQVGMWSSGLAWFLATAGVFSVASLLPLLQGQSVESKSSGIWSADAELWNGRFAMLGLVALAATEFITGAPFV 229          
BLAST of CX296515 vs. ExPASy Swiss-Prot
Match: ELI9_HORVU (Low molecular mass early light-inducible protein HV90, chloroplastic OS=Hordeum vulgare PE=2 SV=1)

HSP 1 Score: 138.272 bits (347), Expect = 3.326e-32
Identity = 69/121 (57.02%), Postives = 85/121 (70.25%), Query Frame = 3
Query:  222 PPKKPRMSTGFSEVFAFSGPAPERINGRLAMIGFVAALGVEISKGQDVFAQLSDG-GVAWFLGTSVLLTVASLVPLFKGVSVESKSDGFMTSDAELWNGRFAMLGLVALAFTEFVKGGTLV 581
            PP KP+ ST   +  AFSGPAPERINGRLAM+GFV AL VE  +G  + +QL  G G AWF  T  +L++ASLVPL +G S E ++   M ++AELWNGRFAMLGLVALA TE + G   +
Sbjct:   50 PPNKPKASTSIWDEMAFSGPAPERINGRLAMVGFVTALAVEAGRGDGLLSQLGSGTGQAWFAYTVAVLSMASLVPLLQGESAEGRAGAIMNANAELWNGRFAMLGLVALAATEIITGAPFI 170          
BLAST of CX296515 vs. ExPASy Swiss-Prot
Match: ELI6_HORVU (Low molecular mass early light-inducible protein HV60, chloroplastic OS=Hordeum vulgare PE=2 SV=1)

HSP 1 Score: 137.887 bits (346), Expect = 4.344e-32
Identity = 68/117 (58.12%), Postives = 84/117 (71.79%), Query Frame = 3
Query:  222 PPKKPRMSTGFSEVFAFSGPAPERINGRLAMIGFVAALGVEISKGQDVFAQLSDG-GVAWFLGTSVLLTVASLVPLFKGVSVESKSDGFMTSDAELWNGRFAMLGLVALAFTEFVKG 569
            PP KP+ ST   +  AFSGPAPERINGRLAM+GFV AL VE  +G  + +QL  G G AWF  T  +L++ASLVPL +G S E ++   M ++AELWNGRFAM+GLVALA TE + G
Sbjct:   45 PPNKPKASTSIWDAMAFSGPAPERINGRLAMVGFVTALAVEAGRGDGLLSQLGSGTGQAWFAYTVAMLSMASLVPLLQGESAEGRAGAIMNANAELWNGRFAMIGLVALAATEIITG 161          
BLAST of CX296515 vs. ExPASy Swiss-Prot
Match: CBR_DUNBA (Carotene biosynthesis-related protein CBR, chloroplastic OS=Dunaliella bardawil GN=CBR PE=1 SV=1)

HSP 1 Score: 92.8189 bits (229), Expect = 1.602e-18
Identity = 61/128 (47.66%), Postives = 73/128 (57.03%), Query Frame = 3
Query:  198 TIPKAEPQPPKKPRMSTG--FSEVFAFSGPAPERINGRLAMIGFVAALGVEISKGQDVFAQLSDGGVAWFLGTSVLLTVASLVPLFKGVSVESKSD--GFMTSDAELWNGRFAMLGLVALAFTEFVKG 569
            T P + P PP  P        +EV  FSG APE INGRLAM+GFVAALG E+S G+ V  QL D      L T VL + ASL+P F       K D  G  T DAE+ NGRFAM+G  A+   E ++G
Sbjct:   47 TPPPSSPSPPPPPPTPAAPTVTEVMGFSG-APEIINGRLAMLGFVAALGAELSTGESVLTQLGDQPTLIAL-TFVLFSAASLIPAF----ARRKGDAMGPFTPDAEMTNGRFAMIGFAAMLVYEGIQG 168          
The following BLAST results are available for this feature:
BLAST of CX296515 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 6
Match NameE-valueIdentityDescription
ELI_PEA8.418e-5263.84Early light-induced protein, chloroplastic OS=Pisu... [more]
DS22_CRAPL2.013e-3748.59Desiccation stress protein DSP-22, chloroplastic O... [more]
ELI5_HORVU6.701e-3357.25High molecular mass early light-inducible protein ... [more]
ELI9_HORVU3.326e-3257.02Low molecular mass early light-inducible protein H... [more]
ELI6_HORVU4.344e-3258.12Low molecular mass early light-inducible protein H... [more]
CBR_DUNBA1.602e-1847.66Carotene biosynthesis-related protein CBR, chlorop... [more]
back to top
Properties
Property NameValue
Genbank descriptionC05142C08SK FerrChloL1 Citrus clementina cDNA clone C05142C08, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CX296515 ID=CX296515|Name=CX296515|organism=Citrus clementina|type=EST|length=645bp
GATTCGGCCGAGGCCTCGTGCCGAATTCGGCACGAGGGGCAAGTCCTGTA
GCAGCTCGTGTGACTGGTATCAGGAGATCCGGGGCAAACCAACTTTCCTC
CGTCAAGTACTTGCCTAGTCTGCGTAGAAATGTCAACTTATCCGTGCGCT
GCACGGCAGAGGATGAGCAGCAGCAGCAGCAGAAAGATGATCAACCAACC
ATACCGAAAGCTGAGCCTCAGCCACCAAAGAAGCCGCGGATGAGCACGGG
GTTCTCTGAGGTGTTCGCGTTCAGCGGGCCGGCACCGGAGAGGATAAACG
GGAGGCTTGCGATGATTGGGTTCGTGGCTGCATTGGGGGTGGAGATATCC
AAGGGTCAGGATGTGTTTGCCCAGTTATCAGACGGTGGGGTTGCCTGGTT
CTTGGGGACCAGTGTTTTGCTCACGGTTGCGTCCCTGGTTCCTTTGTTTA
AAGGTGTCAGCGTGGAGTCTAAATCGGATGGGTTCATGACTTCGGATGCT
GAGTTGTGGAATGGGAGGTTTGCTATGCTGGGCCTTGTTGCTTTGGCTTT
CACCGAGTTTGTTAAGGGTGGCACCCTTGTTTAAGCTTAATTTAATTACA
GTAGGATCTCATACATTAATTAGTTAAAAAAAGGGGGGGCCCGGT
back to top