CX296527

Overview
NameCX296527
Unique NameCX296527
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length688
Libraries
Library NameType
FerrChloL1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of CX296527 vs. ExPASy Swiss-Prot
Match: DJB11_RAT (DnaJ homolog subfamily B member 11 OS=Rattus norvegicus GN=Dnajb11 PE=2 SV=1)

HSP 1 Score: 137.502 bits (345), Expect = 6.425e-32
Identity = 75/161 (46.58%), Postives = 104/161 (64.60%), Query Frame = 1
Query:  232 VIAGKSYYEVLQVPRGASDEQIKRAYRKLALKYHPDKNQGNEEANKRFAEINNAYEVLSDSETRNIYDTYGEEGLKQ-HAAXXXXXXXXXVNIQDIFSSF-------FGGGPMEEDEKIVKGDDVIVELDATLEDLYMGGSLKVWREK-ML*ASPRQRRCN 687
            VIAG+ +Y++L VPR AS + IK+AYRKLAL+ HPD+N  + +A ++F ++  AYEVLSDSE R  YDTYGEEGLK  H +             DIFS F       FGG P ++D  I +G D+IV+L+ TLE++Y G  ++V R K +   +P +R+CN
Sbjct:   20 VIAGRDFYKILGVPRSASIKDIKKAYRKLALQLHPDRNPDDPQAQEKFQDLGAAYEVLSDSEKRKQYDTYGEEGLKDGHQSSHG----------DIFSHFFGDFGFMFGGAPRQQDRNIPRGSDIIVDLEVTLEEVYAGNFVEVVRNKPVARQAPGKRKCN 170          
BLAST of CX296527 vs. ExPASy Swiss-Prot
Match: DJB11_PONAB (DnaJ homolog subfamily B member 11 OS=Pongo abelii GN=DNAJB11 PE=2 SV=1)

HSP 1 Score: 136.732 bits (343), Expect = 1.096e-31
Identity = 75/161 (46.58%), Postives = 104/161 (64.60%), Query Frame = 1
Query:  232 VIAGKSYYEVLQVPRGASDEQIKRAYRKLALKYHPDKNQGNEEANKRFAEINNAYEVLSDSETRNIYDTYGEEGLKQ-HAAXXXXXXXXXVNIQDIFSSF-------FGGGPMEEDEKIVKGDDVIVELDATLEDLYMGGSLKVWREK-ML*ASPRQRRCN 687
            VIAG+ +Y++L VPR AS + IK+AYRKLAL+ HPD+N  + +A ++F ++  AYEVLSDSE R  YDTYGEEGLK  H +             DIFS F       FGG P ++D  I +G D+IV+L+ TLE++Y G  ++V R K +   +P +R+CN
Sbjct:   20 VIAGRDFYKILGVPRSASIKDIKKAYRKLALQLHPDRNPDDPQAQEKFQDLGAAYEVLSDSEKRKQYDTYGEEGLKDGHQSSHG----------DIFSHFFGDFGFMFGGTPRQQDRNIPRGSDIIVDLEVTLEEVYAGNFVEVVRNKPVARQAPGKRKCN 170          
BLAST of CX296527 vs. ExPASy Swiss-Prot
Match: DJB11_MOUSE (DnaJ homolog subfamily B member 11 OS=Mus musculus GN=Dnajb11 PE=1 SV=1)

HSP 1 Score: 136.732 bits (343), Expect = 1.096e-31
Identity = 75/161 (46.58%), Postives = 104/161 (64.60%), Query Frame = 1
Query:  232 VIAGKSYYEVLQVPRGASDEQIKRAYRKLALKYHPDKNQGNEEANKRFAEINNAYEVLSDSETRNIYDTYGEEGLKQ-HAAXXXXXXXXXVNIQDIFSSF-------FGGGPMEEDEKIVKGDDVIVELDATLEDLYMGGSLKVWREK-ML*ASPRQRRCN 687
            VIAG+ +Y++L VPR AS + IK+AYRKLAL+ HPD+N  + +A ++F ++  AYEVLSDSE R  YDTYGEEGLK  H +             DIFS F       FGG P ++D  I +G D+IV+L+ TLE++Y G  ++V R K +   +P +R+CN
Sbjct:   20 VIAGRDFYKILGVPRSASIKDIKKAYRKLALQLHPDRNPDDPQAQEKFQDLGAAYEVLSDSEKRKQYDTYGEEGLKDGHQSSHG----------DIFSHFFGDFGFMFGGTPRQQDRNIPRGSDIIVDLEVTLEEVYAGNFVEVVRNKPVARQAPGKRKCN 170          
BLAST of CX296527 vs. ExPASy Swiss-Prot
Match: DJB11_HUMAN (DnaJ homolog subfamily B member 11 OS=Homo sapiens GN=DNAJB11 PE=1 SV=1)

HSP 1 Score: 136.732 bits (343), Expect = 1.096e-31
Identity = 75/161 (46.58%), Postives = 104/161 (64.60%), Query Frame = 1
Query:  232 VIAGKSYYEVLQVPRGASDEQIKRAYRKLALKYHPDKNQGNEEANKRFAEINNAYEVLSDSETRNIYDTYGEEGLKQ-HAAXXXXXXXXXVNIQDIFSSF-------FGGGPMEEDEKIVKGDDVIVELDATLEDLYMGGSLKVWREK-ML*ASPRQRRCN 687
            VIAG+ +Y++L VPR AS + IK+AYRKLAL+ HPD+N  + +A ++F ++  AYEVLSDSE R  YDTYGEEGLK  H +             DIFS F       FGG P ++D  I +G D+IV+L+ TLE++Y G  ++V R K +   +P +R+CN
Sbjct:   20 VIAGRDFYKILGVPRSASIKDIKKAYRKLALQLHPDRNPDDPQAQEKFQDLGAAYEVLSDSEKRKQYDTYGEEGLKDGHQSSHG----------DIFSHFFGDFGFMFGGTPRQQDRNIPRGSDIIVDLEVTLEEVYAGNFVEVVRNKPVARQAPGKRKCN 170          
BLAST of CX296527 vs. ExPASy Swiss-Prot
Match: DJB11_BOVIN (DnaJ homolog subfamily B member 11 OS=Bos taurus GN=DNAJB11 PE=2 SV=1)

HSP 1 Score: 135.961 bits (341), Expect = 1.869e-31
Identity = 75/161 (46.58%), Postives = 103/161 (63.98%), Query Frame = 1
Query:  232 VIAGKSYYEVLQVPRGASDEQIKRAYRKLALKYHPDKNQGNEEANKRFAEINNAYEVLSDSETRNIYDTYGEEGLKQ-HAAXXXXXXXXXVNIQDIFSSF-------FGGGPMEEDEKIVKGDDVIVELDATLEDLYMGGSLKVWREK-ML*ASPRQRRCN 687
            VIAG+ +Y++L VPR AS + IK+AYRKLAL+ HPD+N  +  A ++F ++  AYEVLSDSE R  YDTYGEEGLK  H +             DIFS F       FGG P ++D  I +G D+IV+L+ TLE++Y G  ++V R K +   +P +R+CN
Sbjct:   20 VIAGRDFYKILGVPRSASIKDIKKAYRKLALQLHPDRNPDDPRAQEKFQDLGAAYEVLSDSEKRKQYDTYGEEGLKDGHQSSHG----------DIFSHFFGDFGFMFGGTPRQQDRNIPRGSDIIVDLEVTLEEVYAGNFVEVVRNKPVARQAPGKRKCN 170          
BLAST of CX296527 vs. ExPASy Swiss-Prot
Match: DJB11_CANFA (DnaJ homolog subfamily B member 11 OS=Canis familiaris GN=DNAJB11 PE=1 SV=2)

HSP 1 Score: 134.42 bits (337), Expect = 5.439e-31
Identity = 74/160 (46.25%), Postives = 102/160 (63.75%), Query Frame = 1
Query:  235 IAGKSYYEVLQVPRGASDEQIKRAYRKLALKYHPDKNQGNEEANKRFAEINNAYEVLSDSETRNIYDTYGEEGLKQ-HAAXXXXXXXXXVNIQDIFSSF-------FGGGPMEEDEKIVKGDDVIVELDATLEDLYMGGSLKVWREK-ML*ASPRQRRCN 687
            IAG+ +Y++L VPR AS + IK+AYRKLAL+ HPD+N  +  A ++F ++  AYEVLSDSE R  YDTYGEEGLK  H +             DIFS F       FGG P ++D  I +G D+IV+L+ TLE++Y G  ++V R K +   +P +R+CN
Sbjct:   21 IAGRDFYKILGVPRSASIKDIKKAYRKLALQLHPDRNPDDPRAQEKFQDLGAAYEVLSDSEKRKQYDTYGEEGLKDGHQSSHG----------DIFSHFFGDFGFMFGGTPRQQDRNIPRGSDIIVDLEVTLEEVYAGNFVEVVRNKPVARQAPGKRKCN 170          
BLAST of CX296527 vs. ExPASy Swiss-Prot
Match: DNAJ_HAEPS (Chaperone protein dnaJ OS=Haemophilus parasuis serovar 5 (strain SH0165) GN=dnaJ PE=3 SV=1)

HSP 1 Score: 114.005 bits (284), Expect = 7.607e-25
Identity = 58/132 (43.94%), Postives = 83/132 (62.88%), Query Frame = 1
Query:  244 KSYYEVLQVPRGASDEQIKRAYRKLALKYHPDKNQGNEEANKRFAEINNAYEVLSDSETRNIYDTYGEEGLKQ---HAAXXXXXXXXXVNIQDIFSSFFGG--GPMEEDEKIVKGDDVIVELDATLEDLYMG 624
            K YYEVL + +GAS+++IKRAY++LA K+HPDKNQG++EA ++F EI  AYEVL D+E R +YD YG +  +                   +DIFS  FGG  G     +++V+GDD+  +L+ TLE+   G
Sbjct:    4 KDYYEVLGLQKGASEQEIKRAYKRLAAKHHPDKNQGSKEAEEKFKEIKEAYEVLGDNEKRAMYDQYGHQAFEHGGGAGGFGGFGGGGFGGFEDIFSEMFGGGFGGGARRQRVVRGDDLRYDLEITLEEAVRG 135          
BLAST of CX296527 vs. ExPASy Swiss-Prot
Match: DNAJ_WOLWR (Chaperone protein dnaJ OS=Wolbachia sp. subsp. Drosophila simulans (strain wRi) GN=dnaJ PE=3 SV=1)

HSP 1 Score: 113.62 bits (283), Expect = 9.935e-25
Identity = 62/135 (45.93%), Postives = 82/135 (60.74%), Query Frame = 1
Query:  244 KSYYEVLQVPRGASDEQIKRAYRKLALKYHPDKNQGNEEANKRFAEINNAYEVLSDSETRNIYDTYGEEGLKQHAAXXXXXXXXXVNIQDIFSSFFGGG--------PMEEDEKIVKGDDVIVELDATLEDLYMG 624
            K YY++L+V R AS ++IK+AY+KLALKYHPD+N GN+EA ++F E+  AYEVLSDSE R  YD YG EG    A+          +  DIF+ FFGGG          +     V G D+  +L+ TLED + G
Sbjct:    4 KDYYDLLEVGRNASIDEIKKAYKKLALKYHPDRNPGNQEAEEKFKEVTAAYEVLSDSEKRAGYDRYGHEG----ASGGFQGFSSAGDFSDIFNDFFGGGFGGGASRSRAKRSTTGVSGADLRYDLEITLEDAFKG 134          
BLAST of CX296527 vs. ExPASy Swiss-Prot
Match: DNAJ_PASHA (Chaperone protein dnaJ OS=Pasteurella haemolytica GN=dnaJ PE=3 SV=1)

HSP 1 Score: 112.849 bits (281), Expect = 1.695e-24
Identity = 58/136 (42.65%), Postives = 86/136 (63.24%), Query Frame = 1
Query:  235 IAGKSYYEVLQVPRGASDEQIKRAYRKLALKYHPDKNQGNEEANKRFAEINNAYEVLSDSETRNIYDTYGEEGLKQHAA----XXXXXXXXXVNIQDIFSSFFGG--GPMEEDEKIVKGDDVIVELDATLEDLYMG 624
            +A K YYEVL + +GAS++ IKRAY++LA K+HPDKNQG++E+ ++F EI  AY+VL+DSE + +YD YG    +Q  A                +DIFS  FGG  G     +++V+GDD+  +++ TLE+   G
Sbjct:    1 MAKKDYYEVLGLSKGASEKDIKRAYKRLAAKHHPDKNQGSKESEEKFKEITEAYDVLTDSEKKAMYDQYGHAAFEQGGAGAGGFGGFGGGGFGGFEDIFSEMFGGGFGGGGRRQRVVRGDDLRYDIEITLEEAVKG 136          
BLAST of CX296527 vs. ExPASy Swiss-Prot
Match: DNAJ_WOLPM (Chaperone protein dnaJ OS=Wolbachia pipientis wMel GN=dnaJ PE=3 SV=1)

HSP 1 Score: 112.464 bits (280), Expect = 2.213e-24
Identity = 61/135 (45.19%), Postives = 82/135 (60.74%), Query Frame = 1
Query:  244 KSYYEVLQVPRGASDEQIKRAYRKLALKYHPDKNQGNEEANKRFAEINNAYEVLSDSETRNIYDTYGEEGLKQHAAXXXXXXXXXVNIQDIFSSFFGGG--------PMEEDEKIVKGDDVIVELDATLEDLYMG 624
            K YY++L+V R AS ++IK+AY+KLAL+YHPD+N GN+EA ++F E+  AYEVLSDSE R  YD YG EG    A+          +  DIF+ FFGGG          +     V G D+  +L+ TLED + G
Sbjct:    4 KDYYDLLEVGRNASIDEIKKAYKKLALRYHPDRNPGNQEAEEKFKEVTAAYEVLSDSEKRAGYDRYGHEG----ASGGFQGFSSAGDFSDIFNDFFGGGFGGGASRSRAKRSTTGVSGADLRYDLEITLEDAFKG 134          
The following BLAST results are available for this feature:
BLAST of CX296527 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
DJB11_RAT6.425e-3246.58DnaJ homolog subfamily B member 11 OS=Rattus norve... [more]
DJB11_PONAB1.096e-3146.58DnaJ homolog subfamily B member 11 OS=Pongo abelii... [more]
DJB11_MOUSE1.096e-3146.58DnaJ homolog subfamily B member 11 OS=Mus musculus... [more]
DJB11_HUMAN1.096e-3146.58DnaJ homolog subfamily B member 11 OS=Homo sapiens... [more]
DJB11_BOVIN1.869e-3146.58DnaJ homolog subfamily B member 11 OS=Bos taurus G... [more]
DJB11_CANFA5.439e-3146.25DnaJ homolog subfamily B member 11 OS=Canis famili... [more]
DNAJ_HAEPS7.607e-2543.94Chaperone protein dnaJ OS=Haemophilus parasuis ser... [more]
DNAJ_WOLWR9.935e-2545.93Chaperone protein dnaJ OS=Wolbachia sp. subsp. Dro... [more]
DNAJ_PASHA1.695e-2442.65Chaperone protein dnaJ OS=Pasteurella haemolytica ... [more]
DNAJ_WOLPM2.213e-2445.19Chaperone protein dnaJ OS=Wolbachia pipientis wMel... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC05142E07SK FerrChloL1 Citrus clementina cDNA clone C05142E07, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CX296527 ID=CX296527|Name=CX296527|organism=Citrus clementina|type=EST|length=688bp
GAGGCCTCGTCCCGAATTCGGCACGAGGCAGCAACGACTTCTGAATTGAC
AGATAAAAATTAAAAAGAAAAAAATTATTGTAATCTCAGAATTTTGCTAA
GATCTGAAAATTAAACCCTAGATTCTAAGTTTCGGAGAGGCATTAAACTC
TCTCCTCTTGTTGATCTATTAATGGCGCATCGGCGAGCAAGGCTGTTGTT
CCTATTGTGCGCACTTTGTTACGCCCTCAACGTCATTGCGGGGAAGAGCT
ACTATGAAGTATTGCAAGTGCCGAGGGGAGCATCGGACGAGCAGATCAAA
AGAGCGTATAGAAAGCTGGCATTGAAGTATCATCCTGATAAAAACCAGGG
GAATGAAGAAGCTAATAAGCGATTTGCTGAGATTAACAATGCGTATGAGG
TGTTATCGGATAGCGAAACGAGGAATATATATGATACATATGGAGAAGAG
GGACTGAAACAGCATGCTGCTGGTGGAGGCAGAGGTGGAGGGATGGGAGT
TAACATTCAAGACATTTTCAGCTCTTTCTTTGGTGGAGGTCCAATGGAAG
AGGATGAGAAAATTGTGAAGGGTGATGATGTTATTGTTGAACTGGATGCA
ACATTGGAAGATTTATACATGGGAGGTTCCCTAAAGGTATGGAGAGAGAA
AATGTTATAAGCCAGCCCCAGGCAAAGGCGCTGTAACT
back to top