CX296746

Overview
NameCX296746
Unique NameCX296746
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length709
Libraries
Library NameType
FerrChloL1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig3120 contig Ccv1_Contig3120:1..704. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CX296746 vs. ExPASy Swiss-Prot
Match: PSAD_SOLLC (Photosystem I reaction center subunit II, chloroplastic OS=Solanum lycopersicum GN=psaD PE=2 SV=1)

HSP 1 Score: 294.664 bits (753), Expect = 3.334e-79
Identity = 149/211 (70.62%), Postives = 158/211 (74.88%), Query Frame = 2
Query:   56 ISMATQAGLFTPSIITTKTSKLLLNPWXXXXXXXXXXXXXXXXXMAQRTVRXXXXXXXXXXXXXXXXVGFTPPQLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWESPKEQIFEMPTGGAAIMRQGPNLLKLARKEQCLALGTRLRSKYKIKYQFYRVFPNGEVQYLHPKDGVYPEKVNPGRQGVGVNYRSIGKNVSPIEVKFTGKAVYDL 688
            ++MATQA LFTP +   K++     PW                    R +R                 GFTPPQLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWESPKEQIFEMPTGGAAIMRQGPNLLKLARKEQCLALGTRLRSKYKI YQFYRVFPNGEVQYLHPKDGVYPEKVNPGR+GVG N+RSIGKN S IEVKFTGK VYD+
Sbjct:    1 MAMATQASLFTPPLSVPKSTTA---PWKQSLVSFSTPKQLKSTVSVTRPIRAMAEEAPAATEEKPAPAGFTPPQLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWESPKEQIFEMPTGGAAIMRQGPNLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNPGREGVGQNFRSIGKNKSAIEVKFTGKQVYDI 208          
BLAST of CX296746 vs. ExPASy Swiss-Prot
Match: PSAD_CUCSA (Photosystem I reaction center subunit II, chloroplastic OS=Cucumis sativus GN=psaD PE=1 SV=1)

HSP 1 Score: 290.041 bits (741), Expect = 8.212e-78
Identity = 148/211 (70.14%), Postives = 163/211 (77.25%), Query Frame = 2
Query:   56 ISMATQAGLFTPSIITTKTSKLLLNPWXXXXXXXXXXXXXXXXXMAQRTVRXXXXXXXXXXXXXXXXVGFTPPQLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWESPKEQIFEMPTGGAAIMRQGPNLLKLARKEQCLALGTRLRSKYKIKYQFYRVFPNGEVQYLHPKDGVYPEKVNPGRQGVGVNYRSIGKNVSPIEVKFTGKAVYDL 688
            ++MATQA LFTPS+ T K++ + + PW                 +   +                   GF+PP+LDP+TPSPIF GSTGGLLRKAQVEEFYVITWESPKEQIFEMPTGGAAIMR+GPNLLKLARKEQCLALGTRLRSKYKIKYQFYRVFPNGEVQYLHPKDGVYPEKVNPGR+GVG N+RSIGKNVSPIEVKFTGK VYDL
Sbjct:    1 MAMATQATLFTPSLSTPKSTGISI-PWKQSSTLSFLTSKPH---LKAASSSRSFKVSAEAETSVEAPAGFSPPELDPSTPSPIFAGSTGGLLRKAQVEEFYVITWESPKEQIFEMPTGGAAIMREGPNLLKLARKEQCLALGTRLRSKYKIKYQFYRVFPNGEVQYLHPKDGVYPEKVNPGREGVGQNFRSIGKNVSPIEVKFTGKQVYDL 207          
BLAST of CX296746 vs. ExPASy Swiss-Prot
Match: PSAD_NICSY (Photosystem I reaction center subunit II, chloroplastic OS=Nicotiana sylvestris GN=psaD PE=2 SV=1)

HSP 1 Score: 287.345 bits (734), Expect = 5.323e-77
Identity = 151/211 (71.56%), Postives = 160/211 (75.83%), Query Frame = 2
Query:   56 ISMATQAGLFTPSIITTKTSKLLLNPWXXXXXXXXXXXXXXXXXMAQRTVRXXXXXXXXXXXXXXXXVGFTPPQLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWESPKEQIFEMPTGGAAIMRQGPNLLKLARKEQCLALGTRLRSKYKIKYQFYRVFPNGEVQYLHPKDGVYPEKVNPGRQGVGVNYRSIGKNVSPIEVKFTGKAVYDL 688
            ++MATQA LFTP++   K+S     PW                  A R +R                VGFTPPQLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWESPKEQIFEMPTGGAAIMR+G NLLKLARKEQCLALGTRLRSKYKI Y+FYRVFPNGEVQYLHPKDGVYPEKVN GRQGVG N+RSIGKN SPIEVKFTGK VYDL
Sbjct:    1 MAMATQASLFTPALSAPKSSA----PWKQSLASFSPKQLKSTVS-APRPIRAMAEEAATKEAEAP--VGFTPPQLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWESPKEQIFEMPTGGAAIMREGANLLKLARKEQCLALGTRLRSKYKINYRFYRVFPNGEVQYLHPKDGVYPEKVNAGRQGVGQNFRSIGKNKSPIEVKFTGKQVYDL 204          
BLAST of CX296746 vs. ExPASy Swiss-Prot
Match: PSAD_SPIOL (Photosystem I reaction center subunit II, chloroplastic OS=Spinacia oleracea GN=psaD PE=1 SV=2)

HSP 1 Score: 282.722 bits (722), Expect = 1.311e-75
Identity = 135/143 (94.41%), Postives = 139/143 (97.20%), Query Frame = 2
Query:  260 GFTPPQLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWESPKEQIFEMPTGGAAIMRQGPNLLKLARKEQCLALGTRLRSKYKIKYQFYRVFPNGEVQYLHPKDGVYPEKVNPGRQGVGVNYRSIGKNVSPIEVKFTGKAVYDL 688
            GFTPP+LDPNTPSPIF GSTGGLLRKAQVEEFYVITWESPKEQIFEMPTGGAAIMR+GPNLLKLARKEQCLALGTRLRSKYKIKYQFYRVFP+GEVQYLHPKDGVYPEKVNPGRQGVG+N RSIGKNVSPIEVKFTGK  YDL
Sbjct:   70 GFTPPELDPNTPSPIFAGSTGGLLRKAQVEEFYVITWESPKEQIFEMPTGGAAIMREGPNLLKLARKEQCLALGTRLRSKYKIKYQFYRVFPSGEVQYLHPKDGVYPEKVNPGRQGVGLNMRSIGKNVSPIEVKFTGKQPYDL 212          
BLAST of CX296746 vs. ExPASy Swiss-Prot
Match: PSAD2_ARATH (Photosystem I reaction center subunit II-2, chloroplastic OS=Arabidopsis thaliana GN=psaD2 PE=1 SV=1)

HSP 1 Score: 280.411 bits (716), Expect = 6.507e-75
Identity = 134/144 (93.06%), Postives = 137/144 (95.14%), Query Frame = 2
Query:  257 VGFTPPQLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWESPKEQIFEMPTGGAAIMRQGPNLLKLARKEQCLALGTRLRSKYKIKYQFYRVFPNGEVQYLHPKDGVYPEKVNPGRQGVGVNYRSIGKNVSPIEVKFTGKAVYDL 688
            VGFTPPQLDPNTPSPIF GSTGGLLRKAQVEEFYVITW SPKEQIFEMPTGGAAIMR+GPNLLKLARKEQCLALGTRLRSKYKI YQFYRVFPNGEVQYLHPKDGVYPEK NPGR+GVG+N RSIGKNVSPIEVKFTGK  YDL
Sbjct:   61 VGFTPPQLDPNTPSPIFAGSTGGLLRKAQVEEFYVITWNSPKEQIFEMPTGGAAIMREGPNLLKLARKEQCLALGTRLRSKYKITYQFYRVFPNGEVQYLHPKDGVYPEKANPGREGVGLNMRSIGKNVSPIEVKFTGKQSYDL 204          
BLAST of CX296746 vs. ExPASy Swiss-Prot
Match: PSAD1_ARATH (Photosystem I reaction center subunit II-1, chloroplastic OS=Arabidopsis thaliana GN=psaD1 PE=1 SV=1)

HSP 1 Score: 280.411 bits (716), Expect = 6.507e-75
Identity = 134/144 (93.06%), Postives = 137/144 (95.14%), Query Frame = 2
Query:  257 VGFTPPQLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWESPKEQIFEMPTGGAAIMRQGPNLLKLARKEQCLALGTRLRSKYKIKYQFYRVFPNGEVQYLHPKDGVYPEKVNPGRQGVGVNYRSIGKNVSPIEVKFTGKAVYDL 688
            VGFTPPQLDPNTPSPIF GSTGGLLRKAQVEEFYVITW SPKEQIFEMPTGGAAIMR+GPNLLKLARKEQCLALGTRLRSKYKI YQFYRVFPNGEVQYLHPKDGVYPEK NPGR+GVG+N RSIGKNVSPIEVKFTGK  YDL
Sbjct:   65 VGFTPPQLDPNTPSPIFAGSTGGLLRKAQVEEFYVITWNSPKEQIFEMPTGGAAIMREGPNLLKLARKEQCLALGTRLRSKYKITYQFYRVFPNGEVQYLHPKDGVYPEKANPGREGVGLNMRSIGKNVSPIEVKFTGKQSYDL 208          
BLAST of CX296746 vs. ExPASy Swiss-Prot
Match: PSAD_HORVU (Photosystem I reaction center subunit II, chloroplastic OS=Hordeum vulgare GN=psaD PE=1 SV=1)

HSP 1 Score: 271.937 bits (694), Expect = 2.314e-72
Identity = 129/143 (90.21%), Postives = 135/143 (94.41%), Query Frame = 2
Query:  260 GFTPPQLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWESPKEQIFEMPTGGAAIMRQGPNLLKLARKEQCLALGTRLRSKYKIKYQFYRVFPNGEVQYLHPKDGVYPEKVNPGRQGVGVNYRSIGKNVSPIEVKFTGKAVYDL 688
            GF PPQLDP+TPSPIFGGSTGGLLRKAQVEEFYVITW SPKEQ+FEMPTGGAAIMR+GPNLLKLARKEQCLALG RLRSKYKI YQFYRVFPNGEVQYLHPKDGVYPEKVN GRQGVG N+RSIGKNVSPIEVKFTGK  +D+
Sbjct:   63 GFVPPQLDPSTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQVFEMPTGGAAIMREGPNLLKLARKEQCLALGNRLRSKYKIAYQFYRVFPNGEVQYLHPKDGVYPEKVNAGRQGVGQNFRSIGKNVSPIEVKFTGKNSFDI 205          
BLAST of CX296746 vs. ExPASy Swiss-Prot
Match: PSAD_CHLRE (Photosystem I reaction center subunit II, chloroplastic OS=Chlamydomonas reinhardtii GN=psaD PE=1 SV=1)

HSP 1 Score: 217.238 bits (552), Expect = 6.765e-56
Identity = 103/137 (75.18%), Postives = 119/137 (86.86%), Query Frame = 2
Query:  263 FTPPQLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWESPKEQIFEMPTGGAAIMRQGPNLLKLARKEQCLALGTRLRSKYKIKYQFYRVFPNGEVQYLHPKDGVYPEKVNPGRQGVGVNYRSIGKNVSPIEVKFTGK 673
            +T P L+P+TPSPIFGGSTGGLLRKAQ EEFYVITWE+ KEQIFEMPTGGAAIMRQGPNLLK  +KEQCLAL T+LR+K+K+   FYRVFP+G+VQYLHP DGVYPEKVN GR G   N R IG+NV+PI+VKF+G+
Sbjct:   53 WTVPTLNPDTPSPIFGGSTGGLLRKAQTEEFYVITWEAKKEQIFEMPTGGAAIMRQGPNLLKFGKKEQCLALTTQLRNKFKLTPCFYRVFPDGKVQYLHPADGVYPEKVNAGRVGANQNMRRIGQNVNPIKVKFSGR 189          
BLAST of CX296746 vs. ExPASy Swiss-Prot
Match: PSAD_CYAPA (Photosystem I reaction center subunit II, cyanelle OS=Cyanophora paradoxa GN=psaD PE=2 SV=1)

HSP 1 Score: 197.978 bits (502), Expect = 4.247e-50
Identity = 93/142 (65.49%), Postives = 114/142 (80.28%), Query Frame = 2
Query:  263 FTPPQLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWESPKEQIFEMPTGGAAIMRQGPNLLKLARKEQCLALGTRLRSKYKI-KYQFYRVFPNGEVQYLHPKDGVYPEKVNPGRQGVGVNYRSIGKNVSPIEVKFTGKAVYD 685
            F+ P L+ N P+PIFGGSTGGLLRKA+VEEFY ITW    E +FE+PTGGAAIMR G NLL+LARKEQC+ALG +L+ K+KI  Y+ YRV+P+GEVQ+LHPKDGV+PEKVNPGR  VG N R IG+N  P ++KF G+  +D
Sbjct:   74 FSVPTLNLNAPTPIFGGSTGGLLRKAEVEEFYSITWTGKSETVFELPTGGAAIMRAGENLLRLARKEQCIALGAQLKDKFKITDYKIYRVYPSGEVQFLHPKDGVFPEKVNPGRVAVGSNKRRIGQNPDPAKLKFKGQETFD 215          
BLAST of CX296746 vs. ExPASy Swiss-Prot
Match: PSAD_GUITH (Photosystem I reaction center subunit II OS=Guillardia theta GN=psaD PE=3 SV=1)

HSP 1 Score: 192.2 bits (487), Expect = 2.330e-48
Identity = 93/137 (67.88%), Postives = 111/137 (81.02%), Query Frame = 2
Query:  278 LDPNTPSPIFGGSTGGLLRKAQVEEFYVITWESPKEQIFEMPTGGAAIMRQGPNLLKLARKEQCLALGTRLRSKYKI-KYQFYRVFPNGEVQYLHPKDGVYPEKVNPGRQGVGVNYRSIGKNVSPIEVKFTGKAVYD 685
            L+   PSP F GSTGG LR A+ EE Y ITW SPKEQ+FEMPTGGAAIMR+G NLL LARKEQCLALGT++++ +KI  Y+ YR+FP+GEVQYLHPKDGV+PEKVNPGR GVG    SIGKN++P ++KFT K+  D
Sbjct:    5 LNLQIPSPTFEGSTGGWLRAAETEEKYAITWTSPKEQVFEMPTGGAAIMRKGENLLYLARKEQCLALGTQVKTSFKITDYKIYRIFPSGEVQYLHPKDGVFPEKVNPGRIGVGNVSHSIGKNLNPAQIKFTNKSFCD 141          
The following BLAST results are available for this feature:
BLAST of CX296746 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 26
Match NameE-valueIdentityDescription
PSAD_SOLLC3.334e-7970.62Photosystem I reaction center subunit II, chloropl... [more]
PSAD_CUCSA8.212e-7870.14Photosystem I reaction center subunit II, chloropl... [more]
PSAD_NICSY5.323e-7771.56Photosystem I reaction center subunit II, chloropl... [more]
PSAD_SPIOL1.311e-7594.41Photosystem I reaction center subunit II, chloropl... [more]
PSAD2_ARATH6.507e-7593.06Photosystem I reaction center subunit II-2, chloro... [more]
PSAD1_ARATH6.507e-7593.06Photosystem I reaction center subunit II-1, chloro... [more]
PSAD_HORVU2.314e-7290.21Photosystem I reaction center subunit II, chloropl... [more]
PSAD_CHLRE6.765e-5675.18Photosystem I reaction center subunit II, chloropl... [more]
PSAD_CYAPA4.247e-5065.49Photosystem I reaction center subunit II, cyanelle... [more]
PSAD_GUITH2.330e-4867.88Photosystem I reaction center subunit II OS=Guilla... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC05802C12SK FerrChloL1 Citrus clementina cDNA clone C05802C12, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CX296746 ID=CX296746|Name=CX296746|organism=Citrus clementina|type=EST|length=709bp
CCGAATTCGGCACGAGGCAAGAACACATCCTCCCCTGCTAACTCGAAAAT
CTACAATTTCCATGGCAACCCAAGCAGGCCTCTTTACCCCAAGTATTATC
ACCACCAAAACAAGCAAGCTTCTTTTGAACCCATGGAAGCCAACCTCATC
CTTTTCATTCACCAGTCCCAAACCCCTCACCTTCTCCATGGCTCAAAGAA
CCGTCAGAGCCGCAGCCGCCGAAGAAAAAACCGAAGCACCCACGAAGGAG
GCTCCAGTAGGCTTCACCCCACCGCAGCTAGACCCAAACACCCCATCCCC
AATCTTCGGAGGAAGCACTGGGGGATTGTTGAGAAAGGCCCAAGTTGAAG
AATTCTATGTCATCACATGGGAGTCGCCAAAGGAACAAATCTTTGAGATG
CCGACTGGTGGAGCTGCCATTATGAGGCAAGGTCCTAACTTGCTTAAGTT
GGCTAGGAAAGAACAGTGCTTGGCTCTTGGTACTAGATTGAGATCAAAGT
ACAAGATCAAGTACCAGTTTTACAGGGTCTTTCCTAATGGTGAGGTTCAA
TATCTTCACCCCAAGGATGGAGTTTATCCTGAAAAAGTGAACCCTGGTCG
CCAGGGAGTGGGAGTGAATTACAGATCAATTGGGAAGAATGTCAGTCCCA
TCGAGGTTAAGTTCACTGGGAAAGCAGTCTATGACTTGTGAGATGCAGAT
GATTGTTTA
back to top