CX296835

Overview
NameCX296835
Unique NameCX296835
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length398
Libraries
Library NameType
FerrChloL1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig12635 contig Ccv1_Contig12635:564..961. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CX296835 vs. ExPASy Swiss-Prot
Match: HS22M_PEA (Heat shock 22 kDa protein, mitochondrial OS=Pisum sativum GN=HSP22 PE=2 SV=1)

HSP 1 Score: 71.2478 bits (173), Expect = 1.761e-12
Identity = 35/43 (81.40%), Postives = 38/43 (88.37%), Query Frame = 3
Query:    3 IDLPEKLYRTDQIKAEMKNGVLKVTVPKVKEEERADVFQVKVD 131
            IDLPEKLY+ D IKAEMKNGVLKVTVPK+KEEER +V  VKVD
Sbjct:  160 IDLPEKLYKIDVIKAEMKNGVLKVTVPKMKEEERNNVINVKVD 202          
BLAST of CX296835 vs. ExPASy Swiss-Prot
Match: HS22M_SOYBN (Heat shock 22 kDa protein, mitochondrial OS=Glycine max GN=HSP23.9 PE=2 SV=1)

HSP 1 Score: 70.4774 bits (171), Expect = 3.004e-12
Identity = 33/43 (76.74%), Postives = 38/43 (88.37%), Query Frame = 3
Query:    3 IDLPEKLYRTDQIKAEMKNGVLKVTVPKVKEEERADVFQVKVD 131
            IDLP+KLY+ DQI+AEMKNGVLKV VPK+KEEER DV  VKV+
Sbjct:  169 IDLPDKLYKIDQIRAEMKNGVLKVVVPKMKEEERKDVISVKVE 211          
BLAST of CX296835 vs. ExPASy Swiss-Prot
Match: HS24M_ORYSJ (24.1 kDa heat shock protein, mitochondrial OS=Oryza sativa subsp. japonica GN=HSP24.1 PE=2 SV=1)

HSP 1 Score: 66.6254 bits (161), Expect = 4.338e-11
Identity = 32/43 (74.42%), Postives = 37/43 (86.05%), Query Frame = 3
Query:    3 IDLPEKLYRTDQIKAEMKNGVLKVTVPKVKEEERADVFQVKVD 131
            I+L  ++YR DQIKAEMKNGVLKV VPKVKEE+R DVFQV V+
Sbjct:  178 IELAPEVYRMDQIKAEMKNGVLKVVVPKVKEEQRRDVFQVNVE 220          
BLAST of CX296835 vs. ExPASy Swiss-Prot
Match: HS23C_CHERU (Small heat shock protein, chloroplastic OS=Chenopodium rubrum GN=HSP23 PE=2 SV=1)

HSP 1 Score: 66.2402 bits (160), Expect = 5.666e-11
Identity = 32/43 (74.42%), Postives = 36/43 (83.72%), Query Frame = 3
Query:    3 IDLPEKLYRTDQIKAEMKNGVLKVTVPKVKEEERADVFQVKVD 131
            I+L   LY+ D IKAEMKNGVLKVTVPK+KEEE+ DVFQV VD
Sbjct:  162 IELTPNLYKIDGIKAEMKNGVLKVTVPKIKEEEKKDVFQVMVD 204          
BLAST of CX296835 vs. ExPASy Swiss-Prot
Match: HS235_ARATH (23.5 kDa heat shock protein, mitochondrial OS=Arabidopsis thaliana GN=HSP23.5 PE=2 SV=1)

HSP 1 Score: 65.855 bits (159), Expect = 7.400e-11
Identity = 28/43 (65.12%), Postives = 38/43 (88.37%), Query Frame = 3
Query:    3 IDLPEKLYRTDQIKAEMKNGVLKVTVPKVKEEERADVFQVKVD 131
            I+LPEK+Y+TD+IKAEMKNGVLKV +PK+KE+ER ++  + VD
Sbjct:  168 IELPEKVYKTDEIKAEMKNGVLKVVIPKIKEDERNNIRHINVD 210          
The following BLAST results are available for this feature:
BLAST of CX296835 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 5
Match NameE-valueIdentityDescription
HS22M_PEA1.761e-1281.40Heat shock 22 kDa protein, mitochondrial OS=Pisum ... [more]
HS22M_SOYBN3.004e-1276.74Heat shock 22 kDa protein, mitochondrial OS=Glycin... [more]
HS24M_ORYSJ4.338e-1174.4224.1 kDa heat shock protein, mitochondrial OS=Oryz... [more]
HS23C_CHERU5.666e-1174.42Small heat shock protein, chloroplastic OS=Chenopo... [more]
HS235_ARATH7.400e-1165.1223.5 kDa heat shock protein, mitochondrial OS=Arab... [more]
back to top
Properties
Property NameValue
Genbank descriptionC05803D02SK FerrChloL1 Citrus clementina cDNA clone C05803D02, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CX296835 ID=CX296835|Name=CX296835|organism=Citrus clementina|type=EST|length=398bp
GGATTGATTTGCCAGAGAAGCTCTACAGGACTGATCAGATCAAGGCTGAG
ATGAAGAATGGTGTGCTGAAGGTGACGGTGCCCAAGGTGAAGGAAGAGGA
GAGGGCTGATGTGTTCCAAGTGAAGGTTGATTAAAGAGTTGGCTTTTAGT
AGTAGCTTTTCTGTCCAGGATATTGAGTGAGAATAATTTTGTGTAGTTTA
TGTGAGCTAACAGTTACAAACATGTTCTGAAATGGTGGTGTTCGGAGTTT
GAATAATTGTGTTACTTCGCATATAATTTTTAGTTTACTTAGTTTTGTTG
GGTAAAACTTTTAGATTTTCACTTCTAAATTCATTTCCCAAGAGAAAATA
GTTGGTGTGACACGTTTTTAATTGGAAAAAAAAAAGGGGGGGCCCGGT
back to top