CX296846

Overview
NameCX296846
Unique NameCX296846
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length757
Libraries
Library NameType
FerrChloL1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig11611 contig Ccv1_Contig11611:594..1350. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CX296846 vs. ExPASy Swiss-Prot
Match: RELA_MYXXA (GTP pyrophosphokinase OS=Myxococcus xanthus GN=relA PE=3 SV=1)

HSP 1 Score: 196.438 bits (498), Expect = 1.371e-49
Identity = 100/226 (44.25%), Postives = 156/226 (69.03%), Query Frame = 3
Query:   21 PTISYLSPN-ELELVRRALMLAFEAHDGQKRRSGEPFIIHPVEVARILGELELDWESIAAGLLHDTVEDTNVVTFERIEEEFGATVRRIVEGETKVSKLGKLKCKNENHSVQDVKADDLRQMFLAMTEEVRVIIVKLADRLHNMRTLSHMPPHKQSSIATETLQVFAPLAKLLGMYQIKSELENLSFMYTNAEDYAKVKRRVADLYKEHEKELEEANKILMKKIED 695
            PT+S   P+ +L+++++A + + + H GQ R+SGEP+++HP+EVA ILGEL+LD  SI  GLLHDT+EDT + T E + E FG+ V  +V+G TK+SK       + + S ++ +A++ R+M +AM +++RVI+VKLADR HNMRTL HM   KQ+ IA ETL ++APLA  LG+  IK+ELE+LSF Y   +++  ++ ++    KE EK +E+   ++  K+ +
Sbjct:   27 PTVSQYHPDPDLDIIKKAYVYSAKVHQGQLRKSGEPYLVHPLEVAGILGELKLDEASIVTGLLHDTIEDT-LATEEELTELFGSEVAHLVDGVTKLSKFSA----SASLSQEEKQAENFRKMIIAMAQDIRVILVKLADRTHNMRTLDHMSEEKQARIAQETLDIYAPLANRLGISWIKTELEDLSFRYVKPQEFFALQAKLNKRKKEREKYIEDTCDLIRSKLAE 247          
BLAST of CX296846 vs. ExPASy Swiss-Prot
Match: RELA_BACSU (GTP pyrophosphokinase OS=Bacillus subtilis GN=relA PE=3 SV=3)

HSP 1 Score: 187.193 bits (474), Expect = 8.315e-47
Identity = 99/222 (44.59%), Postives = 150/222 (67.57%), Query Frame = 3
Query:   30 SYLSPNELELVRRALMLAFEAHDGQKRRSGEPFIIHPVEVARILGELELDWESIAAGLLHDTVEDTNVVTFERIEEEFGATVRRIVEGETKVSKLGKLKCKNENHSVQDVKADDLRQMFLAMTEEVRVIIVKLADRLHNMRTLSHMPPHKQSSIATETLQVFAPLAKLLGMYQIKSELENLSFMYTNAEDYAKVKRRVADLYKEHEKELEEANKILMKKIED 695
            SYLS   +  V +A + A +AH  Q R+SGEP+IIHP++VA IL +LE+D  +IA G LHD VEDT+V T + ++E F   V  +V+G   V+KLGK+K K++    ++ +A++ R+MF+AM +++RVI++KLADRLHNMRTL H+P  KQ  I+ ETL++FAPLA  LG+ +IK ELE+ +  Y N + Y ++   +     E E  ++E    + K++E+
Sbjct:   18 SYLSDEHIAFVEKAYLYAEDAHREQYRKSGEPYIIHPIQVAGILVDLEMDPSTIAGGFLHDVVEDTDV-TLDDLKEAFSEEVAMLVDG---VTKLGKIKYKSQ----EEQQAENHRKMFVAMAQDIRVILIKLADRLHNMRTLKHLPQEKQRRISNETLEIFAPLAHRLGISKIKWELEDTALRYLNPQQYYRIVNLMKKKRAERELYVDEVVNEVKKRVEE 231          
BLAST of CX296846 vs. ExPASy Swiss-Prot
Match: RELA_STREQ (Putative GTP pyrophosphokinase OS=Streptococcus equisimilis GN=relA PE=1 SV=1)

HSP 1 Score: 177.948 bits (450), Expect = 5.045e-44
Identity = 98/228 (42.98%), Postives = 150/228 (65.79%), Query Frame = 3
Query:   33 YLSPNELELVRRALMLAFEAHDGQKRRSGEPFIIHPVEVARILGELELDWESIAAGLLHDTVEDTNVVTFERIEEEFGATVRRIVEGETKVSKLGKLKCKNENHSVQDVKADDLRQMFLAMTEEVRVIIVKLADRLHNMRTLSHMPPHKQSSIATETLQVFAPLAKLLGMYQIKSELENLSFMYTNAEDYAKVKRRVADLYKEHEKELEE-ANKILMKKIEDDQFLDL 713
            Y++  +   V++AL  A  AH  Q R+SGEP+I+HP++VA IL +L LD  ++A G LHD VEDT++ T + IE +FG  VR IV+G   V+KLGK++ K+    +    A++ R+M +AM++++RVI+VKLADRLHNMRTL H+   KQ  I+ ET++++APLA  LG+ +IK ELE+L+F Y N  ++ K+   + +  +E E  +++   KI     E   F D+
Sbjct:   19 YMNETDAAFVKKALDYATAAHFYQVRKSGEPYIVHPIQVAGILADLHLDAVTVACGFLHDVVEDTDI-TLDNIEFDFGKDVRDIVDG---VTKLGKVEYKSHEEQL----AENHRKMLMAMSKDIRVILVKLADRLHNMRTLKHLRKDKQERISRETMEIYAPLAHRLGISRIKWELEDLAFRYLNETEFYKISHMMNEKRREREALVDDIVTKIKSYTTEQGLFGDV 238          
BLAST of CX296846 vs. ExPASy Swiss-Prot
Match: SPOT_SYNY3 (Probable guanosine-3',5'-bis(diphosphate) 3'-pyrophosphohydrolase OS=Synechocystis sp. (strain PCC 6803) GN=spoT PE=3 SV=1)

HSP 1 Score: 177.178 bits (448), Expect = 8.605e-44
Identity = 97/214 (45.33%), Postives = 135/214 (63.08%), Query Frame = 3
Query:   57 LVRRALMLAFEAHDGQKRRSGEPFIIHPVEVARILGELELDWESIAAGLLHDTVEDTNVVTFERIEEEFGATVRRIVEGETKVSKLGKLKCKNENHSVQDVKADDLRQMFLAMTEEVRVIIVKLADRLHNMRTLSHMPPHKQSSIATETLQVFAPLAKLLGMYQIKSELENLSFMYTNAEDYAKVKRRVADLYKEHEKELEEANKILMKKIEDD 698
            L+ RA   A++ H  Q+R+SGEP+I HPV VA +L +L  D   IAAG LHD VEDT++ + E+IE  FG     +VEG TK+SK           S  + +A++ R+MFLAM +++RVI+VKLADRLHNMRTL  + P KQ  IA ET  +FAPLA  LG+++ K ELE+LSF Y   + Y K++  V +   + E  LE    +L  ++ D+
Sbjct:   53 LICRAFCFAYDLHAQQRRKSGEPYIAHPVAVAGLLRDLGGDEAMIAAGFLHDVVEDTDI-SIEQIEALFGEETASLVEGVTKLSKFNF-------SSTTEHQAENFRRMFLAMAKDIRVIVVKLADRLHNMRTLDALSPEKQRRIARETKDIFAPLANRLGIWRFKWELEDLSFKYLEPDSYRKIQSLVVEKRGDRESRLETVKDMLRFRLRDE 258          
BLAST of CX296846 vs. ExPASy Swiss-Prot
Match: SPOT_SHIFL (Guanosine-3',5'-bis(diphosphate) 3'-pyrophosphohydrolase OS=Shigella flexneri GN=spoT PE=3 SV=1)

HSP 1 Score: 174.866 bits (442), Expect = 4.271e-43
Identity = 94/208 (45.19%), Postives = 144/208 (69.23%), Query Frame = 3
Query:    3 LWEDLRPTI-SYLSPNELELVRRALMLAFEAHDGQKRRSGEPFIIHPVEVARILGELELDWESIAAGLLHDTVEDTNVVTFERIEEEFGATVRRIVEGETKVSKLGKLKCKNENHSVQDVKADDLRQMFLAMTEEVRVIIVKLADRLHNMRTLSHMPPHKQSSIATETLQVFAPLAKLLGMYQIKSELENLSFMYTNAEDYAKVKRRV 623
            L+E L   I +YL  ++++ +R+A ++A +AH+GQ R SGEP+I HPV VA IL E++LD+E++ A LLHD +EDT   T++ +E+ FG +V  +VEG   VSKL KLK +++    ++ +A++ R+M +AM +++RVI++KLADR HNMRTL  + P K+  IA ETL++++PLA  LG++ IK+ELE L F       Y  +K  V
Sbjct:    3 LFESLNQLIQTYLPEDQIKRLRQAYLVARDAHEGQTRSSGEPYITHPVAVACILAEMKLDYETLMAALLHDVIEDTPA-TYQDMEQLFGKSVAELVEG---VSKLDKLKFRDK----KEAQAENFRKMIMAMVQDIRVILIKLADRTHNMRTLGSLRPDKRRRIARETLEIYSPLAHRLGIHHIKTELEELGFEALYPNRYRVIKEVV 202          
BLAST of CX296846 vs. ExPASy Swiss-Prot
Match: SPOT_ECOLI (Guanosine-3',5'-bis(diphosphate) 3'-pyrophosphohydrolase OS=Escherichia coli (strain K12) GN=spoT PE=1 SV=1)

HSP 1 Score: 174.866 bits (442), Expect = 4.271e-43
Identity = 94/208 (45.19%), Postives = 144/208 (69.23%), Query Frame = 3
Query:    3 LWEDLRPTI-SYLSPNELELVRRALMLAFEAHDGQKRRSGEPFIIHPVEVARILGELELDWESIAAGLLHDTVEDTNVVTFERIEEEFGATVRRIVEGETKVSKLGKLKCKNENHSVQDVKADDLRQMFLAMTEEVRVIIVKLADRLHNMRTLSHMPPHKQSSIATETLQVFAPLAKLLGMYQIKSELENLSFMYTNAEDYAKVKRRV 623
            L+E L   I +YL  ++++ +R+A ++A +AH+GQ R SGEP+I HPV VA IL E++LD+E++ A LLHD +EDT   T++ +E+ FG +V  +VEG   VSKL KLK +++    ++ +A++ R+M +AM +++RVI++KLADR HNMRTL  + P K+  IA ETL++++PLA  LG++ IK+ELE L F       Y  +K  V
Sbjct:    3 LFESLNQLIQTYLPEDQIKRLRQAYLVARDAHEGQTRSSGEPYITHPVAVACILAEMKLDYETLMAALLHDVIEDTPA-TYQDMEQLFGKSVAELVEG---VSKLDKLKFRDK----KEAQAENFRKMIMAMVQDIRVILIKLADRTHNMRTLGSLRPDKRRRIARETLEIYSPLAHRLGIHHIKTELEELGFEALYPNRYRVIKEVV 202          
BLAST of CX296846 vs. ExPASy Swiss-Prot
Match: SPOT_ECO57 (Guanosine-3',5'-bis(diphosphate) 3'-pyrophosphohydrolase OS=Escherichia coli O157:H7 GN=spoT PE=3 SV=1)

HSP 1 Score: 174.866 bits (442), Expect = 4.271e-43
Identity = 94/208 (45.19%), Postives = 144/208 (69.23%), Query Frame = 3
Query:    3 LWEDLRPTI-SYLSPNELELVRRALMLAFEAHDGQKRRSGEPFIIHPVEVARILGELELDWESIAAGLLHDTVEDTNVVTFERIEEEFGATVRRIVEGETKVSKLGKLKCKNENHSVQDVKADDLRQMFLAMTEEVRVIIVKLADRLHNMRTLSHMPPHKQSSIATETLQVFAPLAKLLGMYQIKSELENLSFMYTNAEDYAKVKRRV 623
            L+E L   I +YL  ++++ +R+A ++A +AH+GQ R SGEP+I HPV VA IL E++LD+E++ A LLHD +EDT   T++ +E+ FG +V  +VEG   VSKL KLK +++    ++ +A++ R+M +AM +++RVI++KLADR HNMRTL  + P K+  IA ETL++++PLA  LG++ IK+ELE L F       Y  +K  V
Sbjct:    3 LFESLNQLIQTYLPEDQIKRLRQAYLVARDAHEGQTRSSGEPYITHPVAVACILAEMKLDYETLMAALLHDVIEDTPA-TYQDMEQLFGKSVAELVEG---VSKLDKLKFRDK----KEAQAENFRKMIMAMVQDIRVILIKLADRTHNMRTLGSLRPDKRRRIARETLEIYSPLAHRLGIHHIKTELEELGFEALYPNRYRVIKEVV 202          
BLAST of CX296846 vs. ExPASy Swiss-Prot
Match: RELA_STAES (GTP pyrophosphokinase OS=Staphylococcus epidermidis (strain ATCC 12228) GN=relA PE=3 SV=1)

HSP 1 Score: 174.866 bits (442), Expect = 4.271e-43
Identity = 98/223 (43.95%), Postives = 147/223 (65.92%), Query Frame = 3
Query:   30 SYLSPNELELVRRALMLAFEAHDGQKRRSGEPFIIHPVEVARILGELELDWESIAAGLLHDTVEDTNVVTFERIEEEFGATVRRIVEGETKVSKLGKLKCKNENHSVQDVKADDLRQMFLAMTEEVRVIIVKLADRLHNMRTLSHMPPHKQSSIATETLQVFAPLAKLLGMYQIKSELENLSFMYTNAEDYAKVKRRVADLYKEHEKELEEANKILMKKIEDD 698
            SYLS +E E V ++  +A+EAH GQ R++G P+I+HP++VA IL E+ LD  +I AG LHD +EDT+  TFE +++ F   + RIV+G TK+ K+ K + K E       +A++ R++F+A+ ++VRVI+VKLADRLHNMRTL  MP  KQ  I+ ETL+++APLA  LG+  IK ELE+ +  Y ++  Y     R+ +L K+   E E      + KI+++
Sbjct:   18 SYLSTSEYEYVLKSYHIAYEAHKGQFRKNGLPYIMHPIQVAGILTEMRLDGPTIVAGFLHDVIEDTSY-TFEDVKDMFNEEIARIVDGVTKLKKV-KYRSKEEQ------QAENHRKLFIAIAKDVRVILVKLADRLHNMRTLKAMPREKQVRISKETLEIYAPLAHRLGINTIKWELEDTALRYIDSVQYF----RIVNLMKKKRSEREAYITNAINKIKNE 228          
BLAST of CX296846 vs. ExPASy Swiss-Prot
Match: RELA_STAEQ (GTP pyrophosphokinase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=relA PE=3 SV=1)

HSP 1 Score: 174.866 bits (442), Expect = 4.271e-43
Identity = 98/223 (43.95%), Postives = 147/223 (65.92%), Query Frame = 3
Query:   30 SYLSPNELELVRRALMLAFEAHDGQKRRSGEPFIIHPVEVARILGELELDWESIAAGLLHDTVEDTNVVTFERIEEEFGATVRRIVEGETKVSKLGKLKCKNENHSVQDVKADDLRQMFLAMTEEVRVIIVKLADRLHNMRTLSHMPPHKQSSIATETLQVFAPLAKLLGMYQIKSELENLSFMYTNAEDYAKVKRRVADLYKEHEKELEEANKILMKKIEDD 698
            SYLS +E E V ++  +A+EAH GQ R++G P+I+HP++VA IL E+ LD  +I AG LHD +EDT+  TFE +++ F   + RIV+G TK+ K+ K + K E       +A++ R++F+A+ ++VRVI+VKLADRLHNMRTL  MP  KQ  I+ ETL+++APLA  LG+  IK ELE+ +  Y ++  Y     R+ +L K+   E E      + KI+++
Sbjct:   18 SYLSTSEYEYVLKSYHIAYEAHKGQFRKNGLPYIMHPIQVAGILTEMRLDGPTIVAGFLHDVIEDTSY-TFEDVKDMFNEEIARIVDGVTKLKKV-KYRSKEEQ------QAENHRKLFIAIAKDVRVILVKLADRLHNMRTLKAMPREKQVRISKETLEIYAPLAHRLGINTIKWELEDTALRYIDSVQYF----RIVNLMKKKRSEREAYITNAINKIKNE 228          
BLAST of CX296846 vs. ExPASy Swiss-Prot
Match: RELA_STAAW (GTP pyrophosphokinase OS=Staphylococcus aureus (strain MW2) GN=relA PE=3 SV=1)

HSP 1 Score: 174.866 bits (442), Expect = 4.271e-43
Identity = 99/219 (45.21%), Postives = 141/219 (64.38%), Query Frame = 3
Query:    9 EDLRPTISYLSPNELELVRRALMLAFEAHDGQKRRSGEPFIIHPVEVARILGELELDWESIAAGLLHDTVEDTNVVTFERIEEEFGATVRRIVEGETKVSKLGKLKCKNENHSVQDVKADDLRQMFLAMTEEVRVIIVKLADRLHNMRTLSHMPPHKQSSIATETLQVFAPLAKLLGMYQIKSELENLSFMYTNAEDYAKVKRRVADLYKEHEKELEEA 665
            E L    SYLS +E E V ++  +A+EAH GQ R++G P+I+HP++VA IL E+ LD  +I AG LHD +EDT   TFE ++E F   V RIV+G TK+ K+ K + K E       +A++ R++F+A+ ++VRVI+VKLADRLHNMRTL  MP  KQ  I+ ETL+++APLA  LG+  IK ELE+ +  Y +   Y ++   +     E E  +E A
Sbjct:   18 EVLHKAKSYLSADEYEYVLKSYHIAYEAHKGQFRKNGLPYIMHPIQVAGILTEMRLDGPTIVAGFLHDVIEDTPY-TFEDVKEMFNEEVARIVDGVTKLKKV-KYRSKEEQ------QAENHRKLFIAIAKDVRVILVKLADRLHNMRTLKAMPREKQIRISRETLEIYAPLAHRLGINTIKWELEDTALRYIDNVQYFRIVNLMKKKRSEREAYIETA 228          
The following BLAST results are available for this feature:
BLAST of CX296846 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 44
Match NameE-valueIdentityDescription
RELA_MYXXA1.371e-4944.25GTP pyrophosphokinase OS=Myxococcus xanthus GN=rel... [more]
RELA_BACSU8.315e-4744.59GTP pyrophosphokinase OS=Bacillus subtilis GN=relA... [more]
RELA_STREQ5.045e-4442.98Putative GTP pyrophosphokinase OS=Streptococcus eq... [more]
SPOT_SYNY38.605e-4445.33Probable guanosine-3',5'-bis(diphosphate) 3'-pyrop... [more]
SPOT_SHIFL4.271e-4345.19Guanosine-3',5'-bis(diphosphate) 3'-pyrophosphohyd... [more]
SPOT_ECOLI4.271e-4345.19Guanosine-3',5'-bis(diphosphate) 3'-pyrophosphohyd... [more]
SPOT_ECO574.271e-4345.19Guanosine-3',5'-bis(diphosphate) 3'-pyrophosphohyd... [more]
RELA_STAES4.271e-4343.95GTP pyrophosphokinase OS=Staphylococcus epidermidi... [more]
RELA_STAEQ4.271e-4343.95GTP pyrophosphokinase OS=Staphylococcus epidermidi... [more]
RELA_STAAW4.271e-4345.21GTP pyrophosphokinase OS=Staphylococcus aureus (st... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC05803E01SK FerrChloL1 Citrus clementina cDNA clone C05803E01, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CX296846 ID=CX296846|Name=CX296846|organism=Citrus clementina|type=EST|length=757bp
GGTTGTGGGAGGATCTTAGGCCCACCATATCATACCTTTCACCTAATGAA
TTGGAATTGGTCCGTAGAGCTCTGATGTTGGCTTTTGAGGCGCATGATGG
TCAGAAAAGACGGAGTGGAGAGCCTTTCATCATTCATCCAGTTGAAGTTG
CTCGTATTCTGGGTGAACTTGAACTGGATTGGGAATCTATTGCTGCGGGA
TTACTACATGACACAGTTGAAGATACAAATGTTGTTACTTTTGAAAGAAT
AGAGGAGGAGTTTGGAGCTACTGTACGCCGCATTGTAGAGGGAGAGACTA
AGGTATCAAAGCTGGGAAAGTTAAAGTGTAAGAATGAAAACCATTCAGTG
CAAGATGTTAAAGCTGATGACCTACGGCAAATGTTTCTAGCCATGACTGA
GGAGGTCCGTGTTATCATAGTCAAATTGGCTGATAGATTGCATAACATGC
GCACTCTTTCACACATGCCTCCACATAAGCAGTCCAGCATTGCAACGGAG
ACATTGCAGGTCTTTGCTCCCTTGGCAAAATTGTTAGGGATGTACCAAAT
TAAGTCTGAACTTGAAAATCTATCCTTTATGTACACAAATGCTGAAGATT
ATGCCAAGGTCAAAAGAAGAGTTGCAGACCTCTATAAAGAACATGAAAAA
GAACTTGAGGAGGCGAACAAAATTTTGATGAAGAAGATTGAGGATGATCA
GTTCTTGGACCTTATGACTGTCAAACTGAAATTCGCTCTGTATGTAAGGA
GCCTTAC
back to top