CX296851

Overview
NameCX296851
Unique NameCX296851
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length728
Libraries
Library NameType
FerrChloL1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of CX296851 vs. ExPASy Swiss-Prot
Match: S17P_WHEAT (Sedoheptulose-1,7-bisphosphatase, chloroplastic OS=Triticum aestivum PE=2 SV=1)

HSP 1 Score: 387.882 bits (995), Expect = 2.999e-107
Identity = 190/214 (88.79%), Postives = 201/214 (93.93%), Query Frame = -1
Query:   84 GSSIVDTNFTVGTIFGVWPGDKLTGVTGRDQVAAAMGIYGPRTTYVIAIKDFPGTHEFLLLDEGKWQHVKETTEIGEGKMFSPGNLRATFDNPDYDKLINYYVKQKYTLRYTGGMVPDVNQIIVKEKGIFTNVTSPSSKAKLRLLFEVAPLGLLIENAGGYSSDGKISVLDKVINDLDDRTQVAYGSKNEIIRFEETLYGSSRLKGGVPVGAAA 725
            GSSIVDTNFTVGTIFGVWPGDKLTGVTG DQVAAAMGIYGPRTT+V+A+KD PGTHEFLLLDEGKWQHVK+TT IGEGKMFSPGNLRATFDNPDYDKL+NYYVK+KYTLRYTGGMVPDVNQIIVKEKGIFTNVTSP++KAKLRLLFEVAPLG LIE AGG+SSDGK SVLDKVI+ LD+RTQVAYGSKNEIIRFEETLYGSSRL     VGA A
Sbjct:  180 GSSIVDTNFTVGTIFGVWPGDKLTGVTGGDQVAAAMGIYGPRTTFVVALKDCPGTHEFLLLDEGKWQHVKDTTSIGEGKMFSPGNLRATFDNPDYDKLVNYYVKEKYTLRYTGGMVPDVNQIIVKEKGIFTNVTSPTAKAKLRLLFEVAPLGFLIEKAGGHSSDGKQSVLDKVISVLDERTQVAYGSKNEIIRFEETLYGSSRLAASATVGATA 393          
BLAST of CX296851 vs. ExPASy Swiss-Prot
Match: S17P_ARATH (Sedoheptulose-1,7-bisphosphatase, chloroplastic OS=Arabidopsis thaliana GN=At3g55800 PE=1 SV=1)

HSP 1 Score: 382.874 bits (982), Expect = 9.647e-106
Identity = 189/214 (88.32%), Postives = 201/214 (93.93%), Query Frame = -1
Query:   84 GSSIVDTNFTVGTIFGVWPGDKLTGVTGRDQVAAAMGIYGPRTTYVIAIKDFPGTHEFLLLDEGKWQHVKETTEIGEGKMFSPGNLRATFDNPDYDKLINYYVKQKYTLRYTGGMVPDVNQIIVKEKGIFTNVTSPSSKAKLRLLFEVAPLGLLIENAGGYSSDGKISVLDKVINDLDDRTQVAYGSKNEIIRFEETLYGSSRLKGGVPVGAAA 725
            GSSIVDTNFTVGTIFGVWPGDKLTG+TG DQVAAAMGIYGPRTTYV+A+K FPGTHEFLLLDEGKWQHVKETTEI EGKMFSPGNLRATFDN +Y KLI+YYVK+KYTLRYTGGMVPDVNQIIVKEKGIFTNVTSP++KAKLRLLFEVAPLGLLIENAGG+SSDG  SVLDK I +LDDRTQVAYGSKNEIIRFEETLYG+SRLK  VP+G  A
Sbjct:  181 GSSIVDTNFTVGTIFGVWPGDKLTGITGGDQVAAAMGIYGPRTTYVLAVKGFPGTHEFLLLDEGKWQHVKETTEIAEGKMFSPGNLRATFDNSEYSKLIDYYVKEKYTLRYTGGMVPDVNQIIVKEKGIFTNVTSPTAKAKLRLLFEVAPLGLLIENAGGFSSDGHKSVLDKTIINLDDRTQVAYGSKNEIIRFEETLYGTSRLK-NVPIGVTA 393          
BLAST of CX296851 vs. ExPASy Swiss-Prot
Match: S17P_SPIOL (Sedoheptulose-1,7-bisphosphatase, chloroplastic OS=Spinacia oleracea PE=2 SV=1)

HSP 1 Score: 370.163 bits (949), Expect = 6.471e-102
Identity = 182/214 (85.05%), Postives = 197/214 (92.06%), Query Frame = -1
Query:   84 GSSIVDTNFTVGTIFGVWPGDKLTGVTGRDQVAAAMGIYGPRTTYVIAIKDFPGTHEFLLLDEGKWQHVKETTEIGEGKMFSPGNLRATFDNPDYDKLINYYVKQKYTLRYTGGMVPDVNQIIVKEKGIFTNVTSPSSKAKLRLLFEVAPLGLLIENAGGYSSDGKISVLDKVINDLDDRTQVAYGSKNEIIRFEETLYGSSRLKGGVPVGAAA 725
            GSSIVDTNF+VGTIFGVWPGDKLTGVTGRDQVAAAMGIYGPRTTYV+A+KD+PGTHEFLLLDEGKWQHVKETTEI EGK+F PGNLRAT DN DY KLI YY+K+KYTLRYTGGMVPDVNQIIVKEKGIFTNV SP++KAKLRLLFEVAPLG LIE AGG+SS+G  SVLD  + +LDDRTQVAYGS NEIIRFE+TLYGSSRL+  VPVGAAA
Sbjct:  174 GSSIVDTNFSVGTIFGVWPGDKLTGVTGRDQVAAAMGIYGPRTTYVLALKDYPGTHEFLLLDEGKWQHVKETTEINEGKLFCPGNLRATSDNADYAKLIQYYIKEKYTLRYTGGMVPDVNQIIVKEKGIFTNVISPTAKAKLRLLFEVAPLGFLIEKAGGHSSEGTKSVLDIEVKNLDDRTQVAYGSLNEIIRFEKTLYGSSRLEEPVPVGAAA 387          
BLAST of CX296851 vs. ExPASy Swiss-Prot
Match: S17P_CHLRE (Sedoheptulose-1,7-bisphosphatase, chloroplastic OS=Chlamydomonas reinhardtii GN=CSBP PE=2 SV=1)

HSP 1 Score: 304.294 bits (778), Expect = 4.361e-82
Identity = 149/204 (73.04%), Postives = 173/204 (84.80%), Query Frame = -1
Query:  120 GSSIVDTNFTVGTIFGVWPGDKLTGVTGRDQVAAAMGIYGPRTTYVIAIKDFPGTHEFLLLDEGKWQHVKETTEIGEGKMFSPGNLRATFDNPDYDKLINYYVKQKYTLRYTGGMVPDVNQIIVKEKGIFTNVTSPSSKAKLRLLFEVAPLGLLIENAGGYSS-DGK-ISVLDKVINDLDDRTQVAYGSKNEIIRFEETLYGSS 725
            GSS  DTNF VGTIFGVWPGDKLT +TGR+QVAA MGIYGPRT + IA+KD PG HEFLL+D+GKW HVKETT IGEGKMF+PGNLRATFDNP Y++LIN+Y+ +KYTLRYTGG+VPD+ QIIVKEKG+FTN+TSP++KAKLR+LFEVAPL LLIE AGG SS DGK +S LD  I   D RTQ+ YGS  E+ RFEE +YG+S
Sbjct:  177 GSSSSDTNFAVGTIFGVWPGDKLTNITGREQVAAGMGIYGPRTVFCIALKDAPGCHEFLLMDDGKWMHVKETTHIGEGKMFAPGNLRATFDNPAYERLINFYLGEKYTLRYTGGIVPDLFQIIVKEKGVFTNLTSPTTKAKLRILFEVAPLALLIEKAGGASSCDGKAVSALDIPILVCDQRTQICYGSIGEVRRFEEYMYGTS 380          
BLAST of CX296851 vs. ExPASy Swiss-Prot
Match: F16PA_GEOUR (Fructose-1,6-bisphosphatase class 1 OS=Geobacter uraniireducens (strain Rf4) GN=fbp PE=3 SV=1)

HSP 1 Score: 132.88 bits (333), Expect = 1.739e-30
Identity = 80/203 (39.41%), Postives = 117/203 (57.64%), Query Frame = -1
Query:  123 GSSIVDTNFTVGTIFGVWPGDKLTGVTGRDQVAAAMGIYGPRTTYVIAIKDFPGTHEFLLLDEGKWQHVKETTEIG-EGKMFSPGNLRATFDNPDYDKLINYYVKQKYTLRYTGGMVPDVNQIIVKEKGIFTN-VTSPSSKAKLRLLFEVAPLGLLIENAGGYSSDGKISVLDKVINDLDDRTQVAYGSKNEIIRFEETLYGS 725
            GSS+VD N  VGTI  ++ G  L    GR QVAA   +YGPR + V  + D  G HEF +    ++   +E   +  +G ++SPG LR  ++  D +K I Y   +   LRY+GG VPD+NQ+++K KG+F     + S   KLRLLFE+ P+  +IE+AGG +++GKI +LD     LD R  +  G   ++ R  E +Y S
Sbjct:  115 GSSLVDVNLAVGTIVSIFSGCDLLQ-EGRKQVAAMYILYGPRVSLVYTVGD--GVHEFTMNQLMEFNLTRENIRMQPDGNIYSPGGLRNKYNEGD-EKFIRYLEAKGCKLRYSGGFVPDINQVLMKGKGLFMYPALNGSPNGKLRLLFELNPMAFIIEHAGGAATNGKIPILDIKPEGLDQRAPIYIGCVEDVNRAMEYVYKS 313          
BLAST of CX296851 vs. ExPASy Swiss-Prot
Match: F16PA_GEOBB (Fructose-1,6-bisphosphatase class 1 OS=Geobacter bemidjiensis (strain Bem / ATCC BAA-1014 / DSM 16622) GN=fbp PE=3 SV=1)

HSP 1 Score: 131.724 bits (330), Expect = 3.874e-30
Identity = 75/193 (38.86%), Postives = 117/193 (60.62%), Query Frame = -1
Query:  153 GSSIVDTNFTVGTIFGVWPGDKLTGVTGRDQVAAAMGIYGPRTTYVIAIKDFPGTHEFLLLDEGKWQHVKETTEIG-EGKMFSPGNLRATFDNPDYDKLINYYVKQKYTLRYTGGMVPDVNQIIVKEKGIFTN-VTSPSSKAKLRLLFEVAPLGLLIENAGGYSSDGKISVLDKVINDLDDRTQVAYGSKNEI 725
            GSS+VD N  VGTI  ++ G  L    GR+QVAA   +YGPR + V  + D  G HEF + +  ++   +E  ++  EG +++PG LR  ++  D +K I +  ++   LRY+GG VPD+NQ+++K KG+F     + S   KLR+LFE+ P+  +IE+AGG +S+G I +LD V   LD R  +  G + ++
Sbjct:  115 GSSLVDVNLAVGTIVSIYAGCDLLQ-PGRNQVAAMYILYGPRVSLVYTVGD--GVHEFTMNNLMEFTLTRENVKMAPEGNIYAPGGLRNKYNAGD-EKFIRHLEEKGCKLRYSGGFVPDINQVLMKGKGLFMYPALNGSPNGKLRVLFELNPMAFIIEHAGGAASNGSIPILDIVPESLDQRAPIYIGCREDV 303          
BLAST of CX296851 vs. ExPASy Swiss-Prot
Match: F16PA_GEOSL (Fructose-1,6-bisphosphatase class 1 OS=Geobacter sulfurreducens GN=fbp PE=3 SV=1)

HSP 1 Score: 130.568 bits (327), Expect = 8.630e-30
Identity = 78/202 (38.61%), Postives = 116/202 (57.43%), Query Frame = -1
Query:  126 GSSIVDTNFTVGTIFGVWPGDKLTGVTGRDQVAAAMGIYGPRTTYVIAIKDFPGTHEFLLLDEGKWQHVKETTEIG-EGKMFSPGNLRATFDNPDYDKLINYYVKQKYTLRYTGGMVPDVNQIIVKEKGIFTN-VTSPSSKAKLRLLFEVAPLGLLIENAGGYSSDGKISVLDKVINDLDDRTQVAYGSKNEIIRFEETLYG 725
            GSS+VD N  VGTI  ++ G  L    GR+QVAA   +YGPR + V ++    G HEF +    ++   +E   +  +G ++SPG LR  +  P+ +K + +   +   LRY+GG VPD+NQ+++K KGIF     + S   KLR+LFE+ P+  LIENAGG ++DGK  +LD     LD R  +  G  N++    E + G
Sbjct:  116 GSSLVDVNLAVGTIVSIYEGCNLLQ-KGRNQVAAMYILYGPRVSLVYSVGK--GVHEFTMNHLMEYTLSRENVTMKPDGDIYSPGGLRKKY-LPETEKFVQHLESKGSKLRYSGGFVPDINQVLMKGKGIFMYPALNGSPNGKLRVLFELNPMAYLIENAGGAATDGKTPILDIEPQSLDQRAPIFIGCSNDVATAMEFMGG 313          
BLAST of CX296851 vs. ExPASy Swiss-Prot
Match: F16PA_GEOLS (Fructose-1,6-bisphosphatase class 1 OS=Geobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ) GN=fbp PE=3 SV=1)

HSP 1 Score: 130.568 bits (327), Expect = 8.630e-30
Identity = 78/203 (38.42%), Postives = 116/203 (57.14%), Query Frame = -1
Query:  123 GSSIVDTNFTVGTIFGVWPGDKLTGVTGRDQVAAAMGIYGPRTTYVIAIKDFPGTHEFLLLDEGKWQHVKETTEIG-EGKMFSPGNLRATFDNPDYDKLINYYVKQKYTLRYTGGMVPDVNQIIVKEKGIFTN-VTSPSSKAKLRLLFEVAPLGLLIENAGGYSSDGKISVLDKVINDLDDRTQVAYGSKNEIIRFEETLYGS 725
            GSS+VD N  VGTI G++ GD L    GR+ V A   +YGPR + V ++    G +EF +    ++   +E  ++   G ++SPG LR  +  P+ +  I Y   +   LRY+GG VPD+NQI++K KGIF     + S   KLRLLFE+ P+  LIE AGG +++G + +LD     LD R  +  G K ++ +  E L G+
Sbjct:  115 GSSLVDVNLAVGTIVGIYQGDNLLQ-PGRNMVGAMYILYGPRVSMVYSVGK--GVYEFTMNHLMEFTLTREKVQMNPSGDIYSPGGLRKKY-TPENEAYIRYLEDKGSKLRYSGGFVPDINQILMKGKGIFMYPALTDSPNGKLRLLFELNPMAYLIEQAGGAATNGCMPILDMQPEGLDQRAPIYIGCKEDVAKATEFLNGA 313          
BLAST of CX296851 vs. ExPASy Swiss-Prot
Match: F16PA_GEOMG (Fructose-1,6-bisphosphatase class 1 OS=Geobacter metallireducens (strain GS-15 / ATCC 53774 / DSM 7210) GN=fbp PE=3 SV=1)

HSP 1 Score: 126.331 bits (316), Expect = 1.627e-28
Identity = 77/198 (38.89%), Postives = 115/198 (58.08%), Query Frame = -1
Query:  138 GSSIVDTNFTVGTIFGVWPGDKLTGVTGRDQVAAAMGIYGPRTTYVIAIKDFPGTHEFLLLDEGKWQHVKETTEIGE-GKMFSPGNLRATFDNPDYDKLINYYVKQKYTLRYTGGMVPDVNQIIVKEKGIFTN-VTSPSSKAKLRLLFEVAPLGLLIENAGGYSSDGKISVLDKVINDLDDRTQVAYGSKNEIIRFEE 725
            GSS+VD N  VGTI  ++ G  L    GR+QVAA   +YGPR + V ++    G HEF +    ++   +E   + E G +++PG LR  +     ++ + Y  ++   LRY+GG VPD+NQ+I+K KGIF     + S   KLRLLFE+  +  L+ENAGG ++DGK  +LD   + LD R  V  G K ++++  E
Sbjct:  116 GSSLVDVNLAVGTIVSIYEGCNLLQ-KGRNQVAALYILYGPRVSMVYSVGR--GVHEFTMNHLMEFTLSRENIVMQEEGNIYAPGGLRNKYQEGT-EQFVRYLEEKGAKLRYSGGFVPDINQVIMKGKGIFMYPALNGSPNGKLRLLFELNAMAYLVENAGGAATDGKQPILDLEPHSLDQRAPVYIGCKADVVKAME 309          
BLAST of CX296851 vs. ExPASy Swiss-Prot
Match: F16PA_PELPD (Fructose-1,6-bisphosphatase class 1 OS=Pelobacter propionicus (strain DSM 2379) GN=fbp PE=3 SV=1)

HSP 1 Score: 124.405 bits (311), Expect = 6.184e-28
Identity = 73/200 (36.50%), Postives = 115/200 (57.50%), Query Frame = -1
Query:  132 GSSIVDTNFTVGTIFGVWPGDKLTGVTGRDQVAAAMGIYGPRTTYVIAIKDFPGTHEFLLLDEGKWQHVKETTEIG-EGKMFSPGNLRATFDNPDYDKLINYYVKQKYTLRYTGGMVPDVNQIIVKEKGIFTN-VTSPSSKAKLRLLFEVAPLGLLIENAGGYSSDGKISVLDKVINDLDDRTQVAYGSKNEIIRFEETL 725
            GSS+VD N  VGTI G++ G  L    GR  V A   +YGPR + V ++    G +EF +    ++   +E  ++   G ++SPG LR  +   + ++ I Y   +   LRY+GG VPD+NQ+++K KG+F     + S   KLRLLFE+ P+  LIE AGG +++G + +LD V   LD R  +  G ++++++  E L
Sbjct:  115 GSSLVDVNLAVGTIVGIYQGSDLLQ-PGRHMVGAMYILYGPRVSMVYSVGK--GVYEFTMNQLMEFTLSREQIQMHPSGDIYSPGGLRKKYCEGN-ERFIRYLEAKGSKLRYSGGFVPDINQVLIKGKGVFMYPALTDSPNGKLRLLFELNPMAFLIEQAGGAATNGHMPILDIVPESLDQRCPIYLGCRDDVVKAAEFL 310          
The following BLAST results are available for this feature:
BLAST of CX296851 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 296
Match NameE-valueIdentityDescription
S17P_WHEAT2.999e-10788.79Sedoheptulose-1,7-bisphosphatase, chloroplastic OS... [more]
S17P_ARATH9.647e-10688.32Sedoheptulose-1,7-bisphosphatase, chloroplastic OS... [more]
S17P_SPIOL6.471e-10285.05Sedoheptulose-1,7-bisphosphatase, chloroplastic OS... [more]
S17P_CHLRE4.361e-8273.04Sedoheptulose-1,7-bisphosphatase, chloroplastic OS... [more]
F16PA_GEOUR1.739e-3039.41Fructose-1,6-bisphosphatase class 1 OS=Geobacter u... [more]
F16PA_GEOBB3.874e-3038.86Fructose-1,6-bisphosphatase class 1 OS=Geobacter b... [more]
F16PA_GEOSL8.630e-3038.61Fructose-1,6-bisphosphatase class 1 OS=Geobacter s... [more]
F16PA_GEOLS8.630e-3038.42Fructose-1,6-bisphosphatase class 1 OS=Geobacter l... [more]
F16PA_GEOMG1.627e-2838.89Fructose-1,6-bisphosphatase class 1 OS=Geobacter m... [more]
F16PA_PELPD6.184e-2836.50Fructose-1,6-bisphosphatase class 1 OS=Pelobacter ... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC05803E06SK FerrChloL1 Citrus clementina cDNA clone C05803E06, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CX296851 ID=CX296851|Name=CX296851|organism=Citrus clementina|type=EST|length=728bp
GAGGTTGTACTTCTATATTGATAGTTTAAAGTTCTTTGCATATCGAAGAA
AAAGAAACACATGAAAGACAACATTATCATTTAAGCAGCTGCTCCAACAG
GAACCCCGCCCTTAAGCCTTGAAGATCCGTATAGAGTTTCTTCAAACCGG
ATAATTTCATTCTTGGAGCCATAGGCAACTTGAGTTCTATCATCAAGATC
GTTTATCACTTTGTCTAGAACCGATATTTTTCCATCGCTACTGTAACCTC
CAGCATTCTCAATCAACAATCCCAAAGGAGCTACCTCAAATAACAGCCTC
AACTTGGCCTTTGAAGAGGGGGATGTTACATTAGTGAAGATACCTTTCTC
TTTAACGATGATCTGATTGACATCTGGCACCATTCCACCTGTGTATCTCA
ATGTGTACTTCTGTTTTACGTAGTAGTTGATCAACTTGTCATAATCAGGA
TTGTCAAAAGTGGCTCTCAAATTTCCAGGGGAGAACATTTTTCCTTCGCC
AATCTCTGTGGTCTCTTTGACATGTTGCCATTTTCCTTCATCAAGAAGAA
GGAACTCGTGTGTTCCCGGAAAATCCTTAATTGCAATAACATATGTGGTT
CGAGGACCATAAATTCCCATGGCTGCGGCAACTTGATCTCTTCCTGTGAC
CCCAGTTAATTTGTCTCCAGGCCACACCCCAAATATGGTTCCTACTGTGA
AGTTTGTGTCGACAATGCTAGATCCCAT
back to top