CX296853

Overview
NameCX296853
Unique NameCX296853
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length694
Libraries
Library NameType
FerrChloL1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig1060 contig Ccv1_Contig1060:85..779. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CX296853 vs. ExPASy Swiss-Prot
Match: PRU1_PRUAR (Major allergen Pru ar 1 OS=Prunus armeniaca PE=1 SV=1)

HSP 1 Score: 170.629 bits (431), Expect = 6.907e-42
Identity = 85/160 (53.12%), Postives = 108/160 (67.50%), Query Frame = 3
Query:   60 MGVLTLNVEDTSTLPPEKLFKLFVLQFDTLLPKVLPQVVKNVELISGDGGPGSIKKFNFVEGADWKYFKHRVDALDKENKIYNYTAIEGEGDANIPTIDHVSYESKVVGTPDGGSKSTVVIKFYPKPGAEIKEEQVKGGLEKEKGIFKALEAYALANPNA 539
            MGV T   E TS +PPEKLFK F+L  D L+PKV P  VK  E++ GDGG G+IKK  F EG+ + Y KHRVD +DK+N  Y+YT I  EGDA    I++++Y+ K+V +PDGGS       ++ K   EIKEEQVK G EK  G+FK +EAY LANP+A
Sbjct:    1 MGVFTYETEFTSVIPPEKLFKAFILDADNLIPKVAPTAVKGTEILEGDGGVGTIKKVTFGEGSQYAYVKHRVDGIDKDNLSYSYTLI--EGDALSDVIENIAYDIKLVASPDGGSIVKTTSHYHTKGDVEIKEEQVKAGKEKAAGLFKLVEAYLLANPDA 158          
BLAST of CX296853 vs. ExPASy Swiss-Prot
Match: PRU1_PRUAV (Major allergen Pru av 1 OS=Prunus avium GN=PRUA1 PE=1 SV=1)

HSP 1 Score: 160.229 bits (404), Expect = 9.335e-39
Identity = 78/160 (48.75%), Postives = 106/160 (66.25%), Query Frame = 3
Query:   60 MGVLTLNVEDTSTLPPEKLFKLFVLQFDTLLPKVLPQVVKNVELISGDGGPGSIKKFNFVEGADWKYFKHRVDALDKENKIYNYTAIEGEGDANIPTIDHVSYESKVVGTPDGGSKSTVVIKFYPKPGAEIKEEQVKGGLEKEKGIFKALEAYALANPNA 539
            MGV T   E TS +PP +LFK FVL  D L+PK+ PQ +K+ E++ GDGGPG+IKK  F EG+ + Y KH++D++DKEN  Y+YT I  EGDA   T++ +SYE+K+V +P GGS       ++ K   EIKEE VK G EK   +FK +E Y   +P+A
Sbjct:    1 MGVFTYESEFTSEIPPPRLFKAFVLDADNLVPKIAPQAIKHSEILEGDGGPGTIKKITFGEGSQYGYVKHKIDSIDKENYSYSYTLI--EGDALGDTLEKISYETKLVASPSGGSIIKSTSHYHTKGNVEIKEEHVKAGKEKASNLFKLIETYLKGHPDA 158          
BLAST of CX296853 vs. ExPASy Swiss-Prot
Match: MAL12_MALDO (Major allergen Mal d 1 OS=Malus domestica PE=1 SV=3)

HSP 1 Score: 150.984 bits (380), Expect = 5.664e-36
Identity = 77/160 (48.12%), Postives = 105/160 (65.62%), Query Frame = 3
Query:   60 MGVLTLNVEDTSTLPPEKLFKLFVLQFDTLLPKVLPQVVKNVELISGDGGPGSIKKFNFVEGADWKYFKHRVDALDKENKIYNYTAIEGEGDANIPTIDHVSYESKVVGTPDGGSKSTVVIKFYPKPGAEIKEEQVKGGLEKEKGIFKALEAYALANPNA 539
            MGV T   E TS +PP +LFK FVL  D L+PK+ PQ +K+ E++ GDGGPG+IKK  F EG+ + Y KH++D++D+ N  Y YT I  EGDA   TI+ VSYE+K+V +   GS    +  ++ K   EIKEE VK G EK  G+FK +E+Y   +P+A
Sbjct:    1 MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFGEGSQYGYVKHKIDSVDEANYSYAYTLI--EGDALTDTIEKVSYETKLVAS-GSGSIIKSISHYHTKGDVEIKEEHVKAGKEKAHGLFKLIESYLKGHPDA 157          
BLAST of CX296853 vs. ExPASy Swiss-Prot
Match: MAL11_MALDO (Major allergen Mal d 1 OS=Malus domestica GN=MALD1 PE=1 SV=2)

HSP 1 Score: 148.288 bits (373), Expect = 3.671e-35
Identity = 77/162 (47.53%), Postives = 107/162 (66.05%), Query Frame = 3
Query:   60 MGVLTLNVEDTSTLPPEKLFKLFVLQFDTLLPKVLPQVVKNVELISGDGGPGSIKKFNFVEGADWKYFKHRVDALDKENKIYNYTAIEGEGDANIPTIDHVSYESKVVGTPDGGSKSTV--VIKFYPKPGAEIKEEQVKGGLEKEKGIFKALEAYALANPNA 539
            MGV T   E TS +PP +LFK FVL  D L+PK+ PQ +K  E++ G+GGPG+IKK  F EG+ + Y KHR+D++D+ +  Y+YT I  EGDA   TI+ +SYE+K+V     GS ST+  +  ++ K   EIKEE VK G EK  G+FK +E+Y   +P+A
Sbjct:    1 MGVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFGEGSQYGYVKHRIDSIDEASYSYSYTLI--EGDALTDTIEKISYETKLVAC---GSGSTIKSISHYHTKGNIEIKEEHVKVGKEKAHGLFKLIESYLKDHPDA 157          
BLAST of CX296853 vs. ExPASy Swiss-Prot
Match: PYRC1_PYRCO (Major allergen Pyr c 1 OS=Pyrus communis GN=PYRC1 PE=1 SV=1)

HSP 1 Score: 147.902 bits (372), Expect = 4.794e-35
Identity = 77/162 (47.53%), Postives = 108/162 (66.67%), Query Frame = 3
Query:   60 MGVLTLNVEDTSTLPPEKLFKLFVLQFDTLLPKVLPQVVKNVELISGDGGPGSIKKFNFVEGADWKYFKHRVDALDKENKIYNYTAIEGEGDANIPTIDHVSYESKVVGTPDGGSKSTV--VIKFYPKPGAEIKEEQVKGGLEKEKGIFKALEAYALANPNA 539
            MG+ T   E TS +PP +LFK FVL  D L+PK+ PQ +K+ E++ G+GGPG+IKK  F EG+ + Y KHRVD++D+ +  Y YT I  EGDA   TI+ +SYE+K+V +   GS ST+  +  ++ K   EIKEE VK G EK  G+FK +E+Y   +P+A
Sbjct:    1 MGLYTFENEFTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGNGGPGTIKKITFGEGSQYGYVKHRVDSIDEASYSYAYTLI--EGDALTDTIEKISYEAKLVAS---GSGSTIKSISHYHTKGDIEIKEEHVKAGKEKAHGLFKLIESYLKDHPDA 157          
BLAST of CX296853 vs. ExPASy Swiss-Prot
Match: BEV1D_BETVE (Major pollen allergen Bet v 1-D/H OS=Betula verrucosa GN=BETV1D PE=1 SV=2)

HSP 1 Score: 142.124 bits (357), Expect = 2.631e-33
Identity = 75/162 (46.30%), Postives = 102/162 (62.96%), Query Frame = 3
Query:   60 MGVLTLNVEDTSTLPPEKLFKLFVLQFDTLLPKVLPQVVKNVELISGDGGPGSIKKFNFVEGADWKYFKHRVDALDKENKIYNYTAIEG--EGDANIPTIDHVSYESKVVGTPDGGSKSTVVIKFYPKPGAEIKEEQVKGGLEKEKGIFKALEAYALANPNA 539
            MGV    +E TS +P  +LFK F+L  D L+PKV PQ + +VE I G+GGPG+IKK NF EG  +KY K RVD +D  N  YNY+ IEG   GD    T++ +S E K+V TPDGG    +  K++ K   E+K EQVK   E  + + +A+E+Y LA+ +A
Sbjct:    1 MGVFNYEIETTSVIPAARLFKAFILDGDNLVPKVAPQAISSVENIEGNGGPGTIKKINFPEGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGD----TLEKISNEIKIVATPDGGCVLKISNKYHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDA 158          
BLAST of CX296853 vs. ExPASy Swiss-Prot
Match: BEV1G_BETVE (Major pollen allergen Bet v 1-G OS=Betula verrucosa GN=BETV1G PE=1 SV=2)

HSP 1 Score: 141.354 bits (355), Expect = 4.487e-33
Identity = 75/162 (46.30%), Postives = 102/162 (62.96%), Query Frame = 3
Query:   60 MGVLTLNVEDTSTLPPEKLFKLFVLQFDTLLPKVLPQVVKNVELISGDGGPGSIKKFNFVEGADWKYFKHRVDALDKENKIYNYTAIEG--EGDANIPTIDHVSYESKVVGTPDGGSKSTVVIKFYPKPGAEIKEEQVKGGLEKEKGIFKALEAYALANPNA 539
            MGV     E TS +P  +LFK F+L+ D L+PKV PQ + +VE I G+GGPG+IKK NF EG  +KY K RVD +D  N  YNY+ IEG   GD    T++ +S E K+V TPDGG    +  K++ K   E+K EQVK   E  + + +A+E+Y LA+ +A
Sbjct:    1 MGVFNYESETTSVIPAARLFKAFILEGDNLIPKVAPQAISSVENIEGNGGPGTIKKINFPEGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGD----TLEKISNEIKIVATPDGGCVLKISNKYHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDA 158          
BLAST of CX296853 vs. ExPASy Swiss-Prot
Match: BEV1A_BETVE (Major pollen allergen Bet v 1-A OS=Betula verrucosa GN=BETVIA PE=1 SV=2)

HSP 1 Score: 139.813 bits (351), Expect = 1.306e-32
Identity = 75/162 (46.30%), Postives = 101/162 (62.35%), Query Frame = 3
Query:   60 MGVLTLNVEDTSTLPPEKLFKLFVLQFDTLLPKVLPQVVKNVELISGDGGPGSIKKFNFVEGADWKYFKHRVDALDKENKIYNYTAIEGE--GDANIPTIDHVSYESKVVGTPDGGSKSTVVIKFYPKPGAEIKEEQVKGGLEKEKGIFKALEAYALANPNA 539
            MGV     E TS +P  +LFK F+L  D L PKV PQ + +VE I G+GGPG+IKK +F EG  +KY K RVD +D  N  YNY+ IEG   GD    T++ +S E K+V TPDGGS   +  K++ K   E+K EQVK   E  + + +A+E+Y LA+ +A
Sbjct:    1 MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFPEGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGD----TLEKISNEIKIVATPDGGSILKISNKYHTKGDHEVKAEQVKASKEMGETLLRAVESYLLAHSDA 158          
BLAST of CX296853 vs. ExPASy Swiss-Prot
Match: BEV1L_BETVE (Major pollen allergen Bet v 1-L OS=Betula verrucosa GN=BETV1L PE=1 SV=2)

HSP 1 Score: 139.428 bits (350), Expect = 1.705e-32
Identity = 74/162 (45.68%), Postives = 101/162 (62.35%), Query Frame = 3
Query:   60 MGVLTLNVEDTSTLPPEKLFKLFVLQFDTLLPKVLPQVVKNVELISGDGGPGSIKKFNFVEGADWKYFKHRVDALDKENKIYNYTAIEG--EGDANIPTIDHVSYESKVVGTPDGGSKSTVVIKFYPKPGAEIKEEQVKGGLEKEKGIFKALEAYALANPNA 539
            MGV     E TS +P  ++FK F+L  D L+PKV PQ + +VE I G+GGPG+IKK NF EG  +KY K RVD +D  N  YNY+ IEG   GD    T++ +S E K+V TPDGG    +  K++ K   E+K EQVK   E  + + +A+E+Y LA+ +A
Sbjct:    1 MGVFNYETEATSVIPAARMFKAFILDGDKLVPKVAPQAISSVENIEGNGGPGTIKKINFPEGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGD----TLEKISNEIKIVATPDGGCVLKISNKYHTKGNHEVKAEQVKASKEMGETLLRAVESYLLAHSDA 158          
BLAST of CX296853 vs. ExPASy Swiss-Prot
Match: PR1_MEDSA (Class-10 pathogenesis-related protein 1 OS=Medicago sativa GN=MSPR10-1 PE=2 SV=1)

HSP 1 Score: 139.043 bits (349), Expect = 2.227e-32
Identity = 68/159 (42.77%), Postives = 102/159 (64.15%), Query Frame = 3
Query:   60 MGVLTLNVEDTSTLPPEKLFKLFVLQFDTLLPKVLPQVVKNVELISGDGGPGSIKKFNFVEGADWKYFKHRVDALDKENKIYNYTAIEGEGDANIPTIDHVSYESKVVGTPDGGSKSTVVIKFYPKPGAEIKEEQVKGGLEKEKGIFKALEAYALANPN 536
            MGV     E TS + P +L+K  V   D L+PKV+   ++++E++ G+GG G+IKK  FVEG + KY  H+VD +D  N  YNY+ + G G  +  T++ +S+ESK+   PDGGS + + +K++ K  A   EE++KGG  +  G+FKALE Y LANP+
Sbjct:    1 MGVFNFEDETTSIVAPARLYKALVTDSDNLIPKVI-DAIQSIEIVEGNGGAGTIKKLTFVEGGETKYDLHKVDLVDDVNFAYNYSIVGGGGLPD--TVEKISFESKLSAGPDGGSTAKLTVKYFTKGDAAPSEEEIKGGKARGDGLFKALEGYVLANPD 156          
The following BLAST results are available for this feature:
BLAST of CX296853 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 43
Match NameE-valueIdentityDescription
PRU1_PRUAR6.907e-4253.13Major allergen Pru ar 1 OS=Prunus armeniaca PE=1 S... [more]
PRU1_PRUAV9.335e-3948.75Major allergen Pru av 1 OS=Prunus avium GN=PRUA1 P... [more]
MAL12_MALDO5.664e-3648.13Major allergen Mal d 1 OS=Malus domestica PE=1 SV=... [more]
MAL11_MALDO3.671e-3547.53Major allergen Mal d 1 OS=Malus domestica GN=MALD1... [more]
PYRC1_PYRCO4.794e-3547.53Major allergen Pyr c 1 OS=Pyrus communis GN=PYRC1 ... [more]
BEV1D_BETVE2.631e-3346.30Major pollen allergen Bet v 1-D/H OS=Betula verruc... [more]
BEV1G_BETVE4.487e-3346.30Major pollen allergen Bet v 1-G OS=Betula verrucos... [more]
BEV1A_BETVE1.306e-3246.30Major pollen allergen Bet v 1-A OS=Betula verrucos... [more]
BEV1L_BETVE1.705e-3245.68Major pollen allergen Bet v 1-L OS=Betula verrucos... [more]
PR1_MEDSA2.227e-3242.77Class-10 pathogenesis-related protein 1 OS=Medicag... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC05803E08SK FerrChloL1 Citrus clementina cDNA clone C05803E08, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CX296853 ID=CX296853|Name=CX296853|organism=Citrus clementina|type=EST|length=694bp
GCCGAATTCGGCACGAGGGTAGTTTTCATCTTCTTTCTTTGTTTAACTCT
TAGACAATCATGGGTGTTCTCACGTTGAATGTAGAGGATACAAGCACTCT
CCCCCCTGAAAAGTTGTTCAAACTTTTTGTCCTTCAGTTCGACACCCTTC
TGCCCAAAGTCCTGCCTCAGGTTGTAAAGAACGTTGAATTGATTTCAGGG
GATGGAGGCCCTGGAAGCATCAAGAAGTTTAACTTTGTTGAAGGTGCTGA
TTGGAAGTACTTTAAGCATAGGGTTGATGCATTGGACAAAGAGAACAAGA
TATACAATTACACGGCAATTGAAGGTGAGGGTGATGCTAACATCCCTACT
ATTGATCATGTTTCTTATGAGAGTAAGGTTGTGGGCACCCCTGACGGAGG
AAGCAAGAGCACCGTTGTTATCAAGTTCTATCCCAAACCAGGTGCCGAGA
TTAAGGAAGAGCAGGTTAAGGGAGGCTTGGAAAAGGAGAAGGGAATTTTT
AAGGCTCTGGAAGCCTATGCCTTGGCAAACCCCAATGCCGTATAAGCTCT
TACGTCAACACTTCACCGCACTTGCGTCGCCTTTGTTGCAACATTATGAA
TAATCATGTTTATGGCTTCCGTATGTCGTGTCTCTTTGTTTTCAATATGC
CAATTTATATAATTGGCTTTTGGCTAAATAAAAAAAAAAAAAAA
back to top