CX296883

Overview
NameCX296883
Unique NameCX296883
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length683
Libraries
Library NameType
FerrChloL1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
CX296883_ssr180 microsatellite CX296883_ssr180:180..191. BLAST: Citrus ESTs to Prunus persica proteins V1
Ccv1_Contig4325 contig Ccv1_Contig4325:11..693. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CX296883 vs. ExPASy Swiss-Prot
Match: AIR12_ARATH (Auxin-induced in root cultures protein 12 OS=Arabidopsis thaliana GN=AIR12 PE=1 SV=3)

HSP 1 Score: 100.908 bits (250), Expect = 6.549e-21
Identity = 62/168 (36.90%), Postives = 90/168 (53.57%), Query Frame = 1
Query:  151 AQQTCGRQAFNNNKVYSTCTDLPVLNSFLHWNYDQSTNTVDLAFRHT-TTSSSRWVAWALNPSGQRMAGSQCLVAFQNSTG-RPVAYTTPIGSGSPTLQPGSLSFQVPNISA-TLEGNQWTIFAXXXXXXXXXXXXXVWQ-EGPMNGDTPGAHAMSGDNARSVGTIDF 642
            +QQ C  Q  N+   + +C DLPVLNS+LH+ Y+ S +++ +AF  T + ++  WVAWA+NP+G +MAGSQ  +A+++  G  PV  T  I S S +L  G L+F   N+ A +L G +  IF              VWQ  G +    PG H    DN  S   + F
Sbjct:   25 SQQACKSQNLNSAGPFDSCEDLPVLNSYLHYTYNSSNSSLSVAFVATPSQANGGWVAWAINPTGTKMAGSQAFLAYRSGGGAAPVVKTYNISSYS-SLVEGKLAFDFWNLRAESLSGGRIAIFTTVKVPAGADSVNQVWQIGGNVTNGRPGVHPFGPDNLGSHRVLSF 191          
The following BLAST results are available for this feature:
BLAST of CX296883 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 1
Match NameE-valueIdentityDescription
AIR12_ARATH6.549e-2136.90Auxin-induced in root cultures protein 12 OS=Arabi... [more]
back to top
Properties
Property NameValue
Genbank descriptionC05803H04SK FerrChloL1 Citrus clementina cDNA clone C05803H04, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CX296883 ID=CX296883|Name=CX296883|organism=Citrus clementina|type=EST|length=683bp
ATTTTGCCTTGGGAAACACTTCCAGTGCTTTCGGGAACTTGTTTTCATTT
CAAGGATTTGATCTGCTTCCTCTAGATCAACATGGTGAACAAAGCTATAG
CATGTGCTTTGTTCTTTAGTTTCGTTGCTGCTCTTTTTGCTTCATCATAT
GCACAACAAACTTGCGGACGCCAGGCTTTCAACAACAACAAAGTATACAG
TACATGCACAGATCTTCCCGTGCTGAATTCATTTCTCCACTGGAATTATG
ATCAGTCAACAAACACCGTCGATCTCGCCTTCCGGCACACGACCACGAGC
TCATCCCGATGGGTGGCATGGGCACTGAACCCATCAGGCCAAAGAATGGC
AGGCTCACAGTGTCTTGTGGCCTTTCAAAACTCAACTGGGCGTCCCGTGG
CTTATACTACTCCTATTGGTTCTGGCTCGCCGACGCTGCAACCGGGTAGT
TTGAGCTTCCAAGTGCCAAATATTTCAGCCACTCTTGAGGGAAATCAATG
GACTATTTTTGCAACTTTGCAGCTTACTAACAATTTGTTGTCAACTAACC
AAGTTTGGCAAGAAGGTCCAATGAACGGTGATACTCCTGGCGCCCATGCC
ATGAGCGGTGATAATGCAAGATCAGTTGGTACCATTGATTTTAGAACCGG
ACAGACCACAGCAGGTGGTGGAAGCTCCGACTC
back to top