CX299948

Overview
NameCX299948
Unique NameCX299948
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length249
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig10362 contig Ccv1_Contig10362:1152..1400. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CX299948 vs. ExPASy Swiss-Prot
Match: RK2_CITSI (50S ribosomal protein L2, chloroplastic OS=Citrus sinensis GN=rpl2-A PE=3 SV=1)

HSP 1 Score: 163.31 bits (412), Expect = 3.420e-40
Identity = 82/82 (100.00%), Postives = 82/82 (100.00%), Query Frame = 2
Query:    2 HNIEITLGKGGQLARAAGAVAKLIAKEGKSATLKLPSGEVRLISKNCSATVGQVGNVGANQKSLGRAGSKCWLGKRPVVRGV 247
            HNIEITLGKGGQLARAAGAVAKLIAKEGKSATLKLPSGEVRLISKNCSATVGQVGNVGANQKSLGRAGSKCWLGKRPVVRGV
Sbjct:  140 HNIEITLGKGGQLARAAGAVAKLIAKEGKSATLKLPSGEVRLISKNCSATVGQVGNVGANQKSLGRAGSKCWLGKRPVVRGV 221          
BLAST of CX299948 vs. ExPASy Swiss-Prot
Match: RK2_BUXMI (50S ribosomal protein L2, chloroplastic OS=Buxus microphylla GN=rpl2-A PE=3 SV=1)

HSP 1 Score: 163.31 bits (412), Expect = 3.420e-40
Identity = 82/82 (100.00%), Postives = 82/82 (100.00%), Query Frame = 2
Query:    2 HNIEITLGKGGQLARAAGAVAKLIAKEGKSATLKLPSGEVRLISKNCSATVGQVGNVGANQKSLGRAGSKCWLGKRPVVRGV 247
            HNIEITLGKGGQLARAAGAVAKLIAKEGKSATLKLPSGEVRLISKNCSATVGQVGNVGANQKSLGRAGSKCWLGKRPVVRGV
Sbjct:  138 HNIEITLGKGGQLARAAGAVAKLIAKEGKSATLKLPSGEVRLISKNCSATVGQVGNVGANQKSLGRAGSKCWLGKRPVVRGV 219          
BLAST of CX299948 vs. ExPASy Swiss-Prot
Match: RK2_NYMAL (50S ribosomal protein L2, chloroplastic OS=Nymphaea alba GN=rpl2-A PE=3 SV=1)

HSP 1 Score: 162.155 bits (409), Expect = 7.618e-40
Identity = 81/82 (98.78%), Postives = 82/82 (100.00%), Query Frame = 2
Query:    2 HNIEITLGKGGQLARAAGAVAKLIAKEGKSATLKLPSGEVRLISKNCSATVGQVGNVGANQKSLGRAGSKCWLGKRPVVRGV 247
            HNIEITLGKGGQLARAAGAVAKLIAKEGKSATL+LPSGEVRLISKNCSATVGQVGNVGANQKSLGRAGSKCWLGKRPVVRGV
Sbjct:  140 HNIEITLGKGGQLARAAGAVAKLIAKEGKSATLRLPSGEVRLISKNCSATVGQVGNVGANQKSLGRAGSKCWLGKRPVVRGV 221          
BLAST of CX299948 vs. ExPASy Swiss-Prot
Match: RK2_VITVI (50S ribosomal protein L2, chloroplastic OS=Vitis vinifera GN=rpl2-A PE=3 SV=1)

HSP 1 Score: 161.77 bits (408), Expect = 9.950e-40
Identity = 81/82 (98.78%), Postives = 81/82 (98.78%), Query Frame = 2
Query:    2 HNIEITLGKGGQLARAAGAVAKLIAKEGKSATLKLPSGEVRLISKNCSATVGQVGNVGANQKSLGRAGSKCWLGKRPVVRGV 247
            HNIEITLGKGGQLARAAGAVAKLIAKEGKSATLKLPSGEVRLISKNCSATVGQVGNVG NQKSLGRAGSKCWLGKRPVVRGV
Sbjct:  140 HNIEITLGKGGQLARAAGAVAKLIAKEGKSATLKLPSGEVRLISKNCSATVGQVGNVGVNQKSLGRAGSKCWLGKRPVVRGV 221          
BLAST of CX299948 vs. ExPASy Swiss-Prot
Match: RK2_SINAL (50S ribosomal protein L2, chloroplastic OS=Sinapis alba GN=rpl2 PE=3 SV=1)

HSP 1 Score: 161.77 bits (408), Expect = 9.950e-40
Identity = 81/82 (98.78%), Postives = 81/82 (98.78%), Query Frame = 2
Query:    2 HNIEITLGKGGQLARAAGAVAKLIAKEGKSATLKLPSGEVRLISKNCSATVGQVGNVGANQKSLGRAGSKCWLGKRPVVRGV 247
            HNIEITLGKGGQLARAAGAVAKLIAKEGKSATLKLPSGEVRLISKNCSATVGQVGNVG NQKSLGRAGSKCWLGKRPVVRGV
Sbjct:  140 HNIEITLGKGGQLARAAGAVAKLIAKEGKSATLKLPSGEVRLISKNCSATVGQVGNVGVNQKSLGRAGSKCWLGKRPVVRGV 221          
BLAST of CX299948 vs. ExPASy Swiss-Prot
Match: RK2_NASOF (50S ribosomal protein L2, chloroplastic OS=Nasturtium officinale GN=rpl2-A PE=3 SV=1)

HSP 1 Score: 161.77 bits (408), Expect = 9.950e-40
Identity = 81/82 (98.78%), Postives = 81/82 (98.78%), Query Frame = 2
Query:    2 HNIEITLGKGGQLARAAGAVAKLIAKEGKSATLKLPSGEVRLISKNCSATVGQVGNVGANQKSLGRAGSKCWLGKRPVVRGV 247
            HNIEITLGKGGQLARAAGAVAKLIAKEGKSATLKLPSGEVRLISKNCSATVGQVGNVG NQKSLGRAGSKCWLGKRPVVRGV
Sbjct:  140 HNIEITLGKGGQLARAAGAVAKLIAKEGKSATLKLPSGEVRLISKNCSATVGQVGNVGVNQKSLGRAGSKCWLGKRPVVRGV 221          
BLAST of CX299948 vs. ExPASy Swiss-Prot
Match: RK2_LOBMA (50S ribosomal protein L2, chloroplastic OS=Lobularia maritima GN=rpl2-A PE=3 SV=1)

HSP 1 Score: 161.77 bits (408), Expect = 9.950e-40
Identity = 81/82 (98.78%), Postives = 81/82 (98.78%), Query Frame = 2
Query:    2 HNIEITLGKGGQLARAAGAVAKLIAKEGKSATLKLPSGEVRLISKNCSATVGQVGNVGANQKSLGRAGSKCWLGKRPVVRGV 247
            HNIEITLGKGGQLARAAGAVAKLIAKEGKSATLKLPSGEVRLISKNCSATVGQVGNVG NQKSLGRAGSKCWLGKRPVVRGV
Sbjct:  140 HNIEITLGKGGQLARAAGAVAKLIAKEGKSATLKLPSGEVRLISKNCSATVGQVGNVGVNQKSLGRAGSKCWLGKRPVVRGV 221          
BLAST of CX299948 vs. ExPASy Swiss-Prot
Match: RK2_LEPVR (50S ribosomal protein L2, chloroplastic OS=Lepidium virginicum GN=rpl2-A PE=3 SV=1)

HSP 1 Score: 161.77 bits (408), Expect = 9.950e-40
Identity = 81/82 (98.78%), Postives = 81/82 (98.78%), Query Frame = 2
Query:    2 HNIEITLGKGGQLARAAGAVAKLIAKEGKSATLKLPSGEVRLISKNCSATVGQVGNVGANQKSLGRAGSKCWLGKRPVVRGV 247
            HNIEITLGKGGQLARAAGAVAKLIAKEGKSATLKLPSGEVRLISKNCSATVGQVGNVG NQKSLGRAGSKCWLGKRPVVRGV
Sbjct:  140 HNIEITLGKGGQLARAAGAVAKLIAKEGKSATLKLPSGEVRLISKNCSATVGQVGNVGVNQKSLGRAGSKCWLGKRPVVRGV 221          
BLAST of CX299948 vs. ExPASy Swiss-Prot
Match: RK2_DRANE (50S ribosomal protein L2, chloroplastic OS=Draba nemorosa GN=rpl2-A PE=3 SV=1)

HSP 1 Score: 161.77 bits (408), Expect = 9.950e-40
Identity = 81/82 (98.78%), Postives = 81/82 (98.78%), Query Frame = 2
Query:    2 HNIEITLGKGGQLARAAGAVAKLIAKEGKSATLKLPSGEVRLISKNCSATVGQVGNVGANQKSLGRAGSKCWLGKRPVVRGV 247
            HNIEITLGKGGQLARAAGAVAKLIAKEGKSATLKLPSGEVRLISKNCSATVGQVGNVG NQKSLGRAGSKCWLGKRPVVRGV
Sbjct:  140 HNIEITLGKGGQLARAAGAVAKLIAKEGKSATLKLPSGEVRLISKNCSATVGQVGNVGVNQKSLGRAGSKCWLGKRPVVRGV 221          
BLAST of CX299948 vs. ExPASy Swiss-Prot
Match: RK2_CRUWA (50S ribosomal protein L2, chloroplastic OS=Crucihimalaya wallichii GN=rpl2-A PE=3 SV=1)

HSP 1 Score: 161.77 bits (408), Expect = 9.950e-40
Identity = 81/82 (98.78%), Postives = 81/82 (98.78%), Query Frame = 2
Query:    2 HNIEITLGKGGQLARAAGAVAKLIAKEGKSATLKLPSGEVRLISKNCSATVGQVGNVGANQKSLGRAGSKCWLGKRPVVRGV 247
            HNIEITLGKGGQLARAAGAVAKLIAKEGKSATLKLPSGEVRLISKNCSATVGQVGNVG NQKSLGRAGSKCWLGKRPVVRGV
Sbjct:  140 HNIEITLGKGGQLARAAGAVAKLIAKEGKSATLKLPSGEVRLISKNCSATVGQVGNVGVNQKSLGRAGSKCWLGKRPVVRGV 221          
The following BLAST results are available for this feature:
BLAST of CX299948 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
RK2_CITSI3.420e-40100.0050S ribosomal protein L2, chloroplastic OS=Citrus ... [more]
RK2_BUXMI3.420e-40100.0050S ribosomal protein L2, chloroplastic OS=Buxus m... [more]
RK2_NYMAL7.618e-4098.7850S ribosomal protein L2, chloroplastic OS=Nymphae... [more]
RK2_VITVI9.950e-4098.7850S ribosomal protein L2, chloroplastic OS=Vitis v... [more]
RK2_SINAL9.950e-4098.7850S ribosomal protein L2, chloroplastic OS=Sinapis... [more]
RK2_NASOF9.950e-4098.7850S ribosomal protein L2, chloroplastic OS=Nasturt... [more]
RK2_LOBMA9.950e-4098.7850S ribosomal protein L2, chloroplastic OS=Lobular... [more]
RK2_LEPVR9.950e-4098.7850S ribosomal protein L2, chloroplastic OS=Lepidiu... [more]
RK2_DRANE9.950e-4098.7850S ribosomal protein L2, chloroplastic OS=Draba n... [more]
RK2_CRUWA9.950e-4098.7850S ribosomal protein L2, chloroplastic OS=Crucihi... [more]

Pages

back to top
Libraries
Library NameType
SaltLeaf1cdna_library
Properties
Property NameValue
Genbank descriptionC07004D01SK SaltLeaf1 Citrus clementina cDNA clone C07004D01, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CX299948 ID=CX299948|Name=CX299948|organism=Citrus clementina|type=EST|length=249bp
ACATAACATAGAAATCACACTTGGAAAGGGTGGACAATTAGCTAGAGCAG
CGGGTGCTGTAGCGAAACTGATTGCAAAAGAGGGGAAATCGGCCACATTA
AAATTACCTTCTGGGGAGGTCCGTTTGATATCCAAAAACTGCTCAGCAAC
AGTCGGACAAGTGGGGAATGTTGGGGCGAACCAGAAAAGTTTGGGTAGAG
CCGGATCTAAATGTTGGCTAGGGAAGCGTCCTGTAGTAAGAGGAGTAGT
back to top