CX299955

Overview
NameCX299955
Unique NameCX299955
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length660
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of CX299955 vs. ExPASy Swiss-Prot
Match: SCP7_ARATH (Serine carboxypeptidase-like 7 OS=Arabidopsis thaliana GN=SCPL7 PE=2 SV=1)

HSP 1 Score: 146.747 bits (369), Expect = 2.909e-51
Identity = 61/88 (69.32%), Postives = 77/88 (87.50%), Query Frame = 1
Query:  223 GYRSLIYSGDHDMIIPFLGTEAWIKSLNYSIVDDWRPWILHSQVAGYTRTYSNQMTYATVKGGGHTAPEYRPAECYAMFQRWINHDPL 486
            GY SLI+SGDHDM +P+LGT+AWI+SLNYS++DDWRPW++  Q+AGYTRTY+N+M +AT+KGGGHT PEY+P E Y MFQRWI+  PL
Sbjct:  351 GYASLIFSGDHDMEVPYLGTQAWIRSLNYSLIDDWRPWMIGDQIAGYTRTYANKMAFATIKGGGHT-PEYKPEESYIMFQRWISGQPL 437          

HSP 2 Score: 75.485 bits (184), Expect = 2.909e-51
Identity = 29/56 (51.79%), Postives = 41/56 (73.21%), Query Frame = 2
Query:   50 CRSYGYLLARYWDNDHNVRKALHIRQGSKGEWIRCNYDLPYTHEIGNSFSYHVSLS 217
            C  Y YLL  YW ND NV++ALH+ +GS GEW+RC +++PY H+I +S  YH++ S
Sbjct:  293 CYMYRYLLTTYWANDENVQRALHVNKGSIGEWVRCYFEIPYNHDIKSSVPYHMNNS 348          
BLAST of CX299955 vs. ExPASy Swiss-Prot
Match: SCP18_ARATH (Serine carboxypeptidase-like 18 OS=Arabidopsis thaliana GN=SCPL18 PE=2 SV=2)

HSP 1 Score: 145.591 bits (366), Expect = 2.018e-49
Identity = 62/87 (71.26%), Postives = 76/87 (87.36%), Query Frame = 1
Query:  226 YRSLIYSGDHDMIIPFLGTEAWIKSLNYSIVDDWRPWILHSQVAGYTRTYSNQMTYATVKGGGHTAPEYRPAECYAMFQRWINHDPL 486
            YRSL+YS DHDM++P++GTEAWIKSLNYSI DDWRPW +++QV GYTRTY+N MT+AT+KGGGHTA EY+P E + MFQRWI+  PL
Sbjct:  379 YRSLVYSSDHDMMVPYIGTEAWIKSLNYSITDDWRPWFVNNQVIGYTRTYANNMTFATIKGGGHTA-EYKPEESFMMFQRWISGRPL 464          

HSP 2 Score: 70.4774 bits (171), Expect = 2.018e-49
Identity = 29/58 (50.00%), Postives = 40/58 (68.97%), Query Frame = 2
Query:   32 TFPPIGCRSYGYLLARYWDNDHNVRKALHIRQGSKGEWIRCNYDLPYTHEIGNSFSYH 205
            + P   C  Y YLLA +W ND +VR+ LH+ +GS G+W+RCN+DLPY  +I +S  YH
Sbjct:  313 SLPTPDCYMYRYLLASHWANDEDVRRELHVVKGSIGKWMRCNWDLPYEKDIKSSVPYH 370          
BLAST of CX299955 vs. ExPASy Swiss-Prot
Match: SCP5_ARATH (Serine carboxypeptidase-like 5 OS=Arabidopsis thaliana GN=SCPL5 PE=2 SV=2)

HSP 1 Score: 144.05 bits (362), Expect = 3.431e-49
Identity = 60/88 (68.18%), Postives = 76/88 (86.36%), Query Frame = 1
Query:  223 GYRSLIYSGDHDMIIPFLGTEAWIKSLNYSIVDDWRPWILHSQVAGYTRTYSNQMTYATVKGGGHTAPEYRPAECYAMFQRWINHDPL 486
            GYRSLIYSGDHD+ +PFL T+AW++SLNYSI+D+WRPW++  Q+ GYT+TY+N+MT+ATV+GGGHTA EY+P E Y MF RWIN  PL
Sbjct:  352 GYRSLIYSGDHDLNVPFLATQAWVRSLNYSIIDNWRPWMIKDQIGGYTKTYANKMTFATVRGGGHTA-EYKPYETYIMFHRWINGQPL 438          

HSP 2 Score: 71.2478 bits (173), Expect = 3.431e-49
Identity = 31/56 (55.36%), Postives = 39/56 (69.64%), Query Frame = 2
Query:   50 CRSYGYLLARYWDNDHNVRKALHIRQGSKGEWIRCNYDLPYTHEIGNSFSYHVSLS 217
            C  Y YLL  YW ND NVRKAL I + S GEW+RC + +PYTH+I +S  YH++ S
Sbjct:  294 CYIYRYLLTTYWVNDVNVRKALQINKESIGEWVRCYFGIPYTHDIKSSVPYHMNNS 349          
BLAST of CX299955 vs. ExPASy Swiss-Prot
Match: SCP1_ARATH (Serine carboxypeptidase-like 1 OS=Arabidopsis thaliana GN=SCPL1 PE=2 SV=1)

HSP 1 Score: 145.976 bits (367), Expect = 1.682e-48
Identity = 63/88 (71.59%), Postives = 77/88 (87.50%), Query Frame = 1
Query:  223 GYRSLIYSGDHDMIIPFLGTEAWIKSLNYSIVDDWRPWILHSQVAGYTRTYSNQMTYATVKGGGHTAPEYRPAECYAMFQRWINHDPL 486
            GYRSLIYSGDHD  +P+LGT+AWI+SLNYSI+DDWRPW++ +Q+AGYTRTY+N+MT+AT+KGGGHTA E +P E   MFQRWIN  PL
Sbjct:  355 GYRSLIYSGDHDFEVPYLGTQAWIRSLNYSIIDDWRPWMVKNQIAGYTRTYANKMTFATIKGGGHTA-ESKPEEASIMFQRWINGQPL 441          

HSP 2 Score: 67.0106 bits (162), Expect = 1.682e-48
Identity = 29/56 (51.79%), Postives = 37/56 (66.07%), Query Frame = 2
Query:   50 CRSYGYLLARYWDNDHNVRKALHIRQGSKGEWIRCNYDLPYTHEIGNSFSYHVSLS 217
            C  Y YLL  YW ND  VR+AL I + S GEW+RC Y +PY ++I +S  YHV+ S
Sbjct:  297 CYIYRYLLTTYWANDATVREALQINKESIGEWVRCYYSIPYNNDIKSSMPYHVNNS 352          
BLAST of CX299955 vs. ExPASy Swiss-Prot
Match: SCP3_ARATH (Serine carboxypeptidase-like 3 OS=Arabidopsis thaliana GN=SCPL3 PE=2 SV=1)

HSP 1 Score: 143.28 bits (360), Expect = 2.857e-48
Identity = 60/88 (68.18%), Postives = 75/88 (85.23%), Query Frame = 1
Query:  223 GYRSLIYSGDHDMIIPFLGTEAWIKSLNYSIVDDWRPWILHSQVAGYTRTYSNQMTYATVKGGGHTAPEYRPAECYAMFQRWINHDPL 486
            GYRSLIYSGDHD  +PFLGT+AWI+SLNYS++DDWRPW++  Q+AGYTRTY+N+MT+AT++GGGHT  E++P E   MFQRWI   PL
Sbjct:  355 GYRSLIYSGDHDFEVPFLGTQAWIRSLNYSVIDDWRPWMIKDQIAGYTRTYANKMTFATIRGGGHTI-EFKPEEASIMFQRWIKGQPL 441          

HSP 2 Score: 68.9366 bits (167), Expect = 2.857e-48
Identity = 28/56 (50.00%), Postives = 40/56 (71.43%), Query Frame = 2
Query:   50 CRSYGYLLARYWDNDHNVRKALHIRQGSKGEWIRCNYDLPYTHEIGNSFSYHVSLS 217
            C  Y +LLA YW ND  VRKAL I++ + GEW+RC+Y +PY ++I +S  YH++ S
Sbjct:  297 CYIYRFLLAAYWANDETVRKALQIKKETIGEWVRCHYGIPYNYDIKSSIPYHMNNS 352          
BLAST of CX299955 vs. ExPASy Swiss-Prot
Match: SCP8_ARATH (Serine carboxypeptidase-like 8 OS=Arabidopsis thaliana GN=SCPL8 PE=1 SV=2)

HSP 1 Score: 142.895 bits (359), Expect = 4.855e-48
Identity = 61/88 (69.32%), Postives = 77/88 (87.50%), Query Frame = 1
Query:  223 GYRSLIYSGDHDMIIPFLGTEAWIKSLNYSIVDDWRPWILHSQVAGYTRTYSNQMTYATVKGGGHTAPEYRPAECYAMFQRWINHDPL 486
            GYRSLIYSGDHD+ +PFL T+AWI+SLNYS + +WRPW++++Q+AGYTR YSN+MT+AT+KGGGHTA EYRP E + MFQRWI+  PL
Sbjct:  347 GYRSLIYSGDHDIAVPFLATQAWIRSLNYSPIHNWRPWMINNQIAGYTRAYSNKMTFATIKGGGHTA-EYRPNETFIMFQRWISGQPL 433          

HSP 2 Score: 68.5514 bits (166), Expect = 4.855e-48
Identity = 29/56 (51.79%), Postives = 38/56 (67.86%), Query Frame = 2
Query:   50 CRSYGYLLARYWDNDHNVRKALHIRQGSKGEWIRCNYDLPYTHEIGNSFSYHVSLS 217
            C  Y Y L   W ND +VR+ALHI +GSKG+W RCN  +PY H+I +S  YH++ S
Sbjct:  289 CYYYPYHLIECWANDESVREALHIEKGSKGKWARCNRTIPYNHDIVSSIPYHMNNS 344          
BLAST of CX299955 vs. ExPASy Swiss-Prot
Match: SCP2_ARATH (Serine carboxypeptidase-like 2 OS=Arabidopsis thaliana GN=SCPL2 PE=2 SV=1)

HSP 1 Score: 147.132 bits (370), Expect = 1.401e-47
Identity = 62/88 (70.45%), Postives = 78/88 (88.64%), Query Frame = 1
Query:  223 GYRSLIYSGDHDMIIPFLGTEAWIKSLNYSIVDDWRPWILHSQVAGYTRTYSNQMTYATVKGGGHTAPEYRPAECYAMFQRWINHDPL 486
            GYRSLIYSGDHD+ +P+LGT+AWI+SLNYSI+DDWRPW++ +Q+AGYTRTY+N+MT+AT+KGGGHT  E++P E   MFQRWIN  PL
Sbjct:  355 GYRSLIYSGDHDLEVPYLGTQAWIRSLNYSIIDDWRPWMIKNQIAGYTRTYANKMTFATIKGGGHTI-EFKPEEASIMFQRWINGQPL 441          

HSP 2 Score: 62.7734 bits (151), Expect = 1.401e-47
Identity = 28/56 (50.00%), Postives = 36/56 (64.29%), Query Frame = 2
Query:   50 CRSYGYLLARYWDNDHNVRKALHIRQGSKGEWIRCNYDLPYTHEIGNSFSYHVSLS 217
            C  Y YLL  YW ND  VR+AL I + S GEW+RC   +PY ++I +S  YHV+ S
Sbjct:  297 CYIYRYLLTTYWANDATVREALQINKESIGEWVRCYRTIPYDNDIKSSMPYHVNNS 352          
BLAST of CX299955 vs. ExPASy Swiss-Prot
Match: SCP4_ARATH (Serine carboxypeptidase-like 4 OS=Arabidopsis thaliana GN=SCPL4 PE=2 SV=1)

HSP 1 Score: 142.895 bits (359), Expect = 5.267e-47
Identity = 62/88 (70.45%), Postives = 75/88 (85.23%), Query Frame = 1
Query:  223 GYRSLIYSGDHDMIIPFLGTEAWIKSLNYSIVDDWRPWILHSQVAGYTRTYSNQMTYATVKGGGHTAPEYRPAECYAMFQRWINHDPL 486
            GYRSLIYSGDHD+ +PFLGT+AWI+SLNYSI+DDWRPW++  Q+AGYT +Y N+MT+ATV GGGHTA E+ P E + MFQRWIN  PL
Sbjct:  355 GYRSLIYSGDHDIQVPFLGTQAWIRSLNYSIIDDWRPWMIKDQIAGYTTSYVNKMTFATVTGGGHTA-EFTPKETFMMFQRWINGQPL 441          

HSP 2 Score: 65.0846 bits (157), Expect = 5.267e-47
Identity = 28/56 (50.00%), Postives = 36/56 (64.29%), Query Frame = 2
Query:   50 CRSYGYLLARYWDNDHNVRKALHIRQGSKGEWIRCNYDLPYTHEIGNSFSYHVSLS 217
            C SY ++L  YW ND  VRKAL I + S GEW RC   +PY H+I +S  YH++ S
Sbjct:  297 CYSYRFMLTTYWANDETVRKALQINKESIGEWTRCYRGIPYNHDIKSSVPYHMNNS 352          
BLAST of CX299955 vs. ExPASy Swiss-Prot
Match: SCP52_ARATH (Putative serine carboxypeptidase-like 52 OS=Arabidopsis thaliana GN=SCPL52 PE=5 SV=1)

HSP 1 Score: 147.902 bits (372), Expect = 5.329e-47
Identity = 64/88 (72.73%), Postives = 77/88 (87.50%), Query Frame = 1
Query:  223 GYRSLIYSGDHDMIIPFLGTEAWIKSLNYSIVDDWRPWILHSQVAGYTRTYSNQMTYATVKGGGHTAPEYRPAECYAMFQRWINHDPL 486
            GYRSLIYSGDHDM +PFL TEAWI+SLNY I+DDWRPWI+++Q+AGYT TY+N+MTYAT+K  GHTA EY+PAE + MFQRWI+  PL
Sbjct:   98 GYRSLIYSGDHDMEVPFLATEAWIRSLNYPIIDDWRPWIINNQIAGYTMTYANKMTYATIKASGHTA-EYKPAESFIMFQRWISGQPL 184          

HSP 2 Score: 60.077 bits (144), Expect = 5.329e-47
Identity = 27/53 (50.94%), Postives = 39/53 (73.58%), Query Frame = 2
Query:   62 GYL-LARYWDNDHNVRKALHIRQGSKGEWIRCNYDLPYTHEIGNSFSYHVSLS 217
            GY+ +A+YW ND  VR+AL IR+GS G+WIRCN ++ Y  +I +S  YH++ S
Sbjct:   43 GYIGIAKYWANDERVREALQIRKGSIGKWIRCNSNIHYDDDIISSIPYHMNNS 95          
BLAST of CX299955 vs. ExPASy Swiss-Prot
Match: SCP10_ARATH (Serine carboxypeptidase-like 10 OS=Arabidopsis thaliana GN=SCPL10 PE=2 SV=1)

HSP 1 Score: 145.976 bits (367), Expect = 1.166e-46
Identity = 66/88 (75.00%), Postives = 76/88 (86.36%), Query Frame = 1
Query:  223 GYRSLIYSGDHDMIIPFLGTEAWIKSLNYSIVDDWRPWILHSQVAGYTRTYSNQMTYATVKGGGHTAPEYRPAECYAMFQRWINHDPL 486
            GYRSLIYSGDHD+ +PF  T+AWIKSLNYSIVDDWRPW+++ Q+AGYTRTYSN+MT+ATVKGGGHTA EY P E   MFQRWI+  PL
Sbjct:  351 GYRSLIYSGDHDITMPFQATQAWIKSLNYSIVDDWRPWMINDQIAGYTRTYSNKMTFATVKGGGHTA-EYLPNESSIMFQRWISGQPL 437          

HSP 2 Score: 60.8474 bits (146), Expect = 1.166e-46
Identity = 25/56 (44.64%), Postives = 36/56 (64.29%), Query Frame = 2
Query:   50 CRSYGYLLARYWDNDHNVRKALHIRQGSKGEWIRCNYDLPYTHEIGNSFSYHVSLS 217
            C  Y Y L   W N+  VR+ALH+ +G+KG+W RCN+ +PY + I +S  YH+  S
Sbjct:  293 CYYYLYFLIECWANNERVREALHVTKGTKGQWQRCNWTIPYDNNIISSVPYHMDNS 348          
The following BLAST results are available for this feature:
BLAST of CX299955 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 42
Match NameE-valueIdentityDescription
SCP7_ARATH2.909e-5169.32Serine carboxypeptidase-like 7 OS=Arabidopsis thal... [more]
SCP18_ARATH2.018e-4971.26Serine carboxypeptidase-like 18 OS=Arabidopsis tha... [more]
SCP5_ARATH3.431e-4968.18Serine carboxypeptidase-like 5 OS=Arabidopsis thal... [more]
SCP1_ARATH1.682e-4871.59Serine carboxypeptidase-like 1 OS=Arabidopsis thal... [more]
SCP3_ARATH2.857e-4868.18Serine carboxypeptidase-like 3 OS=Arabidopsis thal... [more]
SCP8_ARATH4.855e-4869.32Serine carboxypeptidase-like 8 OS=Arabidopsis thal... [more]
SCP2_ARATH1.401e-4770.45Serine carboxypeptidase-like 2 OS=Arabidopsis thal... [more]
SCP4_ARATH5.267e-4770.45Serine carboxypeptidase-like 4 OS=Arabidopsis thal... [more]
SCP52_ARATH5.329e-4772.73Putative serine carboxypeptidase-like 52 OS=Arabid... [more]
SCP10_ARATH1.166e-4675.00Serine carboxypeptidase-like 10 OS=Arabidopsis tha... [more]

Pages

back to top
Libraries
Library NameType
SaltLeaf1cdna_library
Properties
Property NameValue
Genbank descriptionC07004D08SK SaltLeaf1 Citrus clementina cDNA clone C07004D08, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CX299955 ID=CX299955|Name=CX299955|organism=Citrus clementina|type=EST|length=660bp
AGCAATCTCAAGAATTCCTTAATCCTGAACAACATTTCCTCCGATTGGCT
GTCGATCTTATGGATATTTGCTCGCTCGCTATTGGGATAATGACCATAAT
GTCCGTAAGGCACTTCATATAAGACAGGGAAGCAAAGGTGAATGGATACG
CTGCAATTATGATTTACCTTATACGCATGAAATTGGCAATAGTTTTTCCT
ATCATGTAAGCCTCAGTACAAAGGCTACCGCTCTTTAATATATAGTGGGG
ACCATGACATGATCATACCATTCCTGGGAACAGAGGCGTGGATAAAATCT
CTCAATTACTCCATTGTTGATGACTGGAGGCCGTGGATTCTCCACAGCCA
AGTTGCAGGGTATACGAGGACTTACTCCAATCAGATGACGTATGCCACTG
TAAAGGGAGGAGGGCACACTGCTCCTGAGTACAGGCCTGCGGAATGTTAT
GCTATGTTTCAAAGATGGATAAATCATGATCCATTGTAGTTGCCTGCAAT
TTCTAGCTAGTATTTGGTCCAAAGTAATCTATATCAATAATTGATCATGT
ATGATCATGTTTCCTCATGTTAGGTATCAGTGTTGACAATAAACAGACAT
TCATGAAAAGCACACATTCATAATAAATGGAAGCTAATTTTACCAAAAAA
AAAAAAAAAA
back to top