CX300205

Overview
NameCX300205
Unique NameCX300205
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length423
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig15404 contig Ccv1_Contig15404:292..714. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CX300205 vs. ExPASy Swiss-Prot
Match: TRXF2_ARATH (Thioredoxin F-type 2, chloroplastic OS=Arabidopsis thaliana GN=At5g16400 PE=2 SV=1)

HSP 1 Score: 190.66 bits (483), Expect = 1.994e-48
Identity = 90/106 (84.91%), Postives = 100/106 (94.34%), Query Frame = 2
Query:    2 VTEVNKDTFWPIVKAAGDKTVVLDMYTQWCGPCKVIAPKFQELAKKYSDVIFLKLDCNQENKSLAKELGIRVVPTFKILKDNKVVKEVTGAKLEDLVFAIDAVRSG 319
            VTEV+KDTFWPIVKAAGDK VVLDMYTQWCGPCKVIAPK++EL++KY D++FLKLDCNQ+NK LAKELGIRVVPTFKILKDNKVVKEVTGAK EDL+ AI+A RSG
Sbjct:   80 VTEVDKDTFWPIVKAAGDKIVVLDMYTQWCGPCKVIAPKYKELSEKYQDMVFLKLDCNQDNKPLAKELGIRVVPTFKILKDNKVVKEVTGAKYEDLLAAIEAARSG 185          
BLAST of CX300205 vs. ExPASy Swiss-Prot
Match: TRXF_PEA (Thioredoxin F-type, chloroplastic OS=Pisum sativum PE=2 SV=1)

HSP 1 Score: 187.963 bits (476), Expect = 1.293e-47
Identity = 88/105 (83.81%), Postives = 99/105 (94.29%), Query Frame = 2
Query:    2 VTEVNKDTFWPIVKAAGDKTVVLDMYTQWCGPCKVIAPKFQELAKKYSDVIFLKLDCNQENKSLAKELGIRVVPTFKILKDNKVVKEVTGAKLEDLVFAIDAVRS 316
            VTEVNKDTFWPIV AAGDKTVVLDM+T+WCGPCKVIAP ++EL++KY DV+FLKLDCNQ+NKSLAKELGI+VVPTFKILKDNK+VKEVTGAK +DLV AID VRS
Sbjct:   77 VTEVNKDTFWPIVNAAGDKTVVLDMFTKWCGPCKVIAPLYEELSQKYLDVVFLKLDCNQDNKSLAKELGIKVVPTFKILKDNKIVKEVTGAKFDDLVAAIDTVRS 181          
BLAST of CX300205 vs. ExPASy Swiss-Prot
Match: TRXF1_ARATH (Thioredoxin F-type 1, chloroplastic OS=Arabidopsis thaliana GN=At3g02730 PE=1 SV=2)

HSP 1 Score: 180.644 bits (457), Expect = 2.064e-45
Identity = 85/105 (80.95%), Postives = 96/105 (91.43%), Query Frame = 2
Query:    2 VTEVNKDTFWPIVKAAGDKTVVLDMYTQWCGPCKVIAPKFQELAKKYSDVIFLKLDCNQENKSLAKELGIRVVPTFKILKDNKVVKEVTGAKLEDLVFAIDAVRS 316
            VTEV+KDTFWPIVKAAG+K VVLDMYTQWCGPCKVIAPK++ L++KY DV+FLKLDCN +N+ LAKELGIRVVPTFKILKDNKVVKEVTGAK +DLV AI+  RS
Sbjct:   70 VTEVDKDTFWPIVKAAGEKLVVLDMYTQWCGPCKVIAPKYKALSEKYDDVVFLKLDCNPDNRPLAKELGIRVVPTFKILKDNKVVKEVTGAKYDDLVAAIETARS 174          
BLAST of CX300205 vs. ExPASy Swiss-Prot
Match: TRXF_BRANA (Thioredoxin F-type, chloroplastic OS=Brassica napus GN=TRXF PE=2 SV=1)

HSP 1 Score: 180.259 bits (456), Expect = 2.695e-45
Identity = 85/105 (80.95%), Postives = 96/105 (91.43%), Query Frame = 2
Query:    2 VTEVNKDTFWPIVKAAGDKTVVLDMYTQWCGPCKVIAPKFQELAKKYSDVIFLKLDCNQENKSLAKELGIRVVPTFKILKDNKVVKEVTGAKLEDLVFAIDAVRS 316
            VTEV+KDTFWPIVKAAG+K VVLDMYTQWCGPCKVIAPK++ L++KY DV+FLKLDCN EN+ LAKELGIRVVPTFKILKDN+VVKEVTGAK +DLV AI+  RS
Sbjct:   73 VTEVDKDTFWPIVKAAGEKIVVLDMYTQWCGPCKVIAPKYKALSEKYEDVVFLKLDCNPENRPLAKELGIRVVPTFKILKDNQVVKEVTGAKYDDLVAAIETARS 177          
BLAST of CX300205 vs. ExPASy Swiss-Prot
Match: TRXF_SPIOL (Thioredoxin F-type, chloroplastic OS=Spinacia oleracea PE=1 SV=2)

HSP 1 Score: 176.022 bits (445), Expect = 5.083e-44
Identity = 84/105 (80.00%), Postives = 95/105 (90.48%), Query Frame = 2
Query:    2 VTEVNKDTFWPIVKAAGDKTVVLDMYTQWCGPCKVIAPKFQELAKKYSDVIFLKLDCNQENKSLAKELGIRVVPTFKILKDNKVVKEVTGAKLEDLVFAIDAVRS 316
            VTEVNKDTFWPIVKAAGDK VVLDM+TQWCGPCK +APK+++LA++Y DVIFLKLDCNQENK+LAKELGIRVVPTFKILK+N VV EVTGAK + L+ AI A RS
Sbjct:   85 VTEVNKDTFWPIVKAAGDKPVVLDMFTQWCGPCKAMAPKYEKLAEEYLDVIFLKLDCNQENKTLAKELGIRVVPTFKILKENSVVGEVTGAKYDKLLEAIQAARS 189          
BLAST of CX300205 vs. ExPASy Swiss-Prot
Match: TRXF_MESCR (Thioredoxin F-type, chloroplastic OS=Mesembryanthemum crystallinum PE=2 SV=1)

HSP 1 Score: 173.326 bits (438), Expect = 3.295e-43
Identity = 83/105 (79.05%), Postives = 91/105 (86.67%), Query Frame = 2
Query:    2 VTEVNKDTFWPIVKAAGDKTVVLDMYTQWCGPCKVIAPKFQELAKKYSDVIFLKLDCNQENKSLAKELGIRVVPTFKILKDNKVVKEVTGAKLEDLVFAIDAVRS 316
            VTEV+KDTFWPI   AGDK VVLDMYTQWCGPCKV+APK+QELA+K  DV+FLKLDCNQENK LAKELGIRVVPTFKILK  K+V EVTGAK + LV AI+A RS
Sbjct:   86 VTEVDKDTFWPIANGAGDKPVVLDMYTQWCGPCKVMAPKYQELAEKLLDVVFLKLDCNQENKPLAKELGIRVVPTFKILKGGKIVDEVTGAKFDKLVAAIEAARS 190          
BLAST of CX300205 vs. ExPASy Swiss-Prot
Match: THIO_CALJA (Thioredoxin OS=Callithrix jacchus GN=TXN PE=3 SV=3)

HSP 1 Score: 83.5741 bits (205), Expect = 3.433e-16
Identity = 41/97 (42.27%), Postives = 62/97 (63.92%), Query Frame = 2
Query:   14 NKDTFWPIVKAAGDKTVVLDMYTQWCGPCKVIAPKFQELAKKYSDVIFLKLDCNQENKSLAKELGIRVVPTFKILKDNKVVKEVTGAKLEDLVFAID 304
            +KD F   + AAGDK VV+D    WCGPCK+I P F  L++KYS+V+FL++D + + + +A E  ++ +PTF+  K  + V E +GA  E L   I+
Sbjct:    7 SKDAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVVFLEVDVD-DCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKLEATIN 102          
BLAST of CX300205 vs. ExPASy Swiss-Prot
Match: THIO_HUMAN (Thioredoxin OS=Homo sapiens GN=TXN PE=1 SV=3)

HSP 1 Score: 81.2629 bits (199), Expect = 1.704e-15
Identity = 41/97 (42.27%), Postives = 61/97 (62.89%), Query Frame = 2
Query:   14 NKDTFWPIVKAAGDKTVVLDMYTQWCGPCKVIAPKFQELAKKYSDVIFLKLDCNQENKSLAKELGIRVVPTFKILKDNKVVKEVTGAKLEDLVFAID 304
            +K  F   + AAGDK VV+D    WCGPCK+I P F  L++KYS+VIFL++D + + + +A E  ++ +PTF+  K  + V E +GA  E L   I+
Sbjct:    7 SKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVD-DCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKLEATIN 102          
BLAST of CX300205 vs. ExPASy Swiss-Prot
Match: TRXH1_ARATH (Thioredoxin H-type 1 OS=Arabidopsis thaliana GN=TRX1 PE=1 SV=1)

HSP 1 Score: 79.7221 bits (195), Expect = 4.957e-15
Identity = 41/84 (48.81%), Postives = 57/84 (67.86%), Query Frame = 2
Query:   41 KAAGDKT-VVLDMYTQWCGPCKVIAPKFQELAKKYSDVIFLKLDCNQENKSLAKELGIRVVPTFKILKDNKVVKEVTGAKLEDL 289
            KA   KT VV+D    WCGPC+ IAP F +LAKK  +V+FLK+D   E KS+A +  I+ +PTF  LK+ K++ +V GAK ++L
Sbjct:   23 KANESKTLVVVDFTASWCGPCRFIAPFFADLAKKLPNVLFLKVD-TDELKSVASDWAIQAMPTFMFLKEGKILDKVVGAKKDEL 105          
BLAST of CX300205 vs. ExPASy Swiss-Prot
Match: THIO_RABIT (Thioredoxin OS=Oryctolagus cuniculus GN=TXN PE=1 SV=2)

HSP 1 Score: 79.337 bits (194), Expect = 6.475e-15
Identity = 37/97 (38.14%), Postives = 62/97 (63.92%), Query Frame = 2
Query:   14 NKDTFWPIVKAAGDKTVVLDMYTQWCGPCKVIAPKFQELAKKYSDVIFLKLDCNQENKSLAKELGIRVVPTFKILKDNKVVKEVTGAKLEDLVFAID 304
            +K  F  ++ +AGDK VV+D    WCGPCK+I P F  L++K+++V+F+++D + + K +A E  ++ +PTF+  K  + V E +GA  E L   I+
Sbjct:    7 SKSAFQEVLDSAGDKLVVVDFSATWCGPCKMIKPFFHALSEKFNNVVFIEVDVD-DCKDIAAECEVKCMPTFQFFKKGQKVGEFSGANKEKLEATIN 102          
The following BLAST results are available for this feature:
BLAST of CX300205 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 56
Match NameE-valueIdentityDescription
TRXF2_ARATH1.994e-4884.91Thioredoxin F-type 2, chloroplastic OS=Arabidopsis... [more]
TRXF_PEA1.293e-4783.81Thioredoxin F-type, chloroplastic OS=Pisum sativum... [more]
TRXF1_ARATH2.064e-4580.95Thioredoxin F-type 1, chloroplastic OS=Arabidopsis... [more]
TRXF_BRANA2.695e-4580.95Thioredoxin F-type, chloroplastic OS=Brassica napu... [more]
TRXF_SPIOL5.083e-4480.00Thioredoxin F-type, chloroplastic OS=Spinacia oler... [more]
TRXF_MESCR3.295e-4379.05Thioredoxin F-type, chloroplastic OS=Mesembryanthe... [more]
THIO_CALJA3.433e-1642.27Thioredoxin OS=Callithrix jacchus GN=TXN PE=3 SV=3[more]
THIO_HUMAN1.704e-1542.27Thioredoxin OS=Homo sapiens GN=TXN PE=1 SV=3[more]
TRXH1_ARATH4.957e-1548.81Thioredoxin H-type 1 OS=Arabidopsis thaliana GN=TR... [more]
THIO_RABIT6.475e-1538.14Thioredoxin OS=Oryctolagus cuniculus GN=TXN PE=1 S... [more]

Pages

back to top
Libraries
Library NameType
SaltLeaf1cdna_library
Properties
Property NameValue
Genbank descriptionC07007D09SK SaltLeaf1 Citrus clementina cDNA clone C07007D09, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CX300205 ID=CX300205|Name=CX300205|organism=Citrus clementina|type=EST|length=423bp
GGTCACTGAAGTAAATAAGGATACTTTTTGGCCCATCGTTAAGGCCGCCG
GTGATAAGACTGTTGTTCTTGATATGTACACTCAATGGTGTGGTCCTTGT
AAAGTGATAGCTCCAAAATTTCAAGAATTAGCCAAAAAGTACTCCGATGT
TATATTTCTAAAGCTTGATTGCAACCAAGAGAACAAGTCATTGGCGAAAG
AGCTTGGAATAAGGGTTGTTCCTACTTTCAAGATTCTGAAAGACAATAAG
GTTGTAAAGGAAGTGACGGGGGCCAAATTGGAAGACCTAGTTTTCGCCAT
TGATGCTGTTAGATCCGGTTGAAAATTCTTTCCTATTATTTCTCCTGTAA
ACTATAAGCAATATGATCAGCAATGTGTACGTGCTTGAGAATAATTGATT
GTTCCACTTGTATGTATTTATGT
back to top