CX300211

Overview
NameCX300211
Unique NameCX300211
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length392
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig15412 contig Ccv1_Contig15412:470..861. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CX300211 vs. ExPASy Swiss-Prot
Match: ACYP_SPHWW (Acylphosphatase OS=Sphingomonas wittichii (strain RW1 / DSM 6014 / JCM 10273) GN=acyP PE=3 SV=1)

HSP 1 Score: 74.3294 bits (181), Expect = 2.097e-13
Identity = 40/82 (48.78%), Postives = 51/82 (62.20%), Query Frame = 1
Query:    1 RGVFYRNWTIENATQLGLKGWVRNRRDGSVEALFSGNPDSVKEMEQRCCHGPSDAVVTGLQVFPSNDDPGT---GFVRKQTV 237
            +GV++R WT+E A +LGL GWVRNR DGSVEA+ +G  D V+EM  RC  G   + V  + V    D PG    GF +K TV
Sbjct:   21 QGVWFRAWTVEQAAELGLDGWVRNRADGSVEAVAAGPADRVEEMIARCRRGSPASRVDSIDV---EDTPGVVAQGFTQKPTV 99          
BLAST of CX300211 vs. ExPASy Swiss-Prot
Match: ACYP_RHOFD (Acylphosphatase OS=Rhodoferax ferrireducens (strain DSM 15236 / ATCC BAA-621 / T118) GN=acyP PE=3 SV=1)

HSP 1 Score: 73.559 bits (179), Expect = 3.577e-13
Identity = 35/68 (51.47%), Postives = 43/68 (63.24%), Query Frame = 1
Query:    1 RGVFYRNWTIENATQLGLKGWVRNRRDGSVEALFSGNPDSVKEMEQRCCHGPSDAVVTGLQVFPSNDD 204
            +GVFYR   +  A  LGL+GWVRNR DGSVEA+  G    V  M +    GPS+AVVT + +FPS  D
Sbjct:   15 QGVFYRGSMVSRANALGLRGWVRNRLDGSVEAVVQGEATEVNRMVEWARRGPSNAVVTSVNIFPSEGD 82          
BLAST of CX300211 vs. ExPASy Swiss-Prot
Match: ACYP_RHORT (Acylphosphatase OS=Rhodospirillum rubrum (strain ATCC 11170 / NCIB 8255) GN=acyP PE=3 SV=1)

HSP 1 Score: 72.4034 bits (176), Expect = 7.969e-13
Identity = 38/79 (48.10%), Postives = 48/79 (60.76%), Query Frame = 1
Query:    1 RGVFYRNWTIENATQLGLKGWVRNRRDGSVEALFSGNPDSVKEMEQRCCHGPSDAVVTGLQVFPSNDDPGTGFVRKQTV 237
            +GV+YR WT+E A  LGL GWVRNR DG+VEALF G   +V+ M   C  GP  A V  L+V P       GF +K ++
Sbjct:   13 QGVWYRGWTVETAKGLGLAGWVRNRADGTVEALFHGPEAAVEAMLIACRGGPPSARVDDLRVTPVAAPDQPGFSQKPSL 91          
BLAST of CX300211 vs. ExPASy Swiss-Prot
Match: ACYP_NITHX (Acylphosphatase OS=Nitrobacter hamburgensis (strain X14 / DSM 10229) GN=acyP PE=3 SV=1)

HSP 1 Score: 72.0182 bits (175), Expect = 1.041e-12
Identity = 34/64 (53.12%), Postives = 45/64 (70.31%), Query Frame = 1
Query:    1 RGVFYRNWTIENATQLGLKGWVRNRRDGSVEALFSGNPDSVKEMEQRCCHGPSDAVVTGLQVFP 192
            +GV +R WT+  A +LG+ GWVRNRRDGSVEALF+G  D+V +M  RC +GP  A V  ++  P
Sbjct:   15 QGVGFRYWTMREAIRLGVAGWVRNRRDGSVEALFAGPADAVADMVARCRNGPGAARVDAVEDQP 78          
BLAST of CX300211 vs. ExPASy Swiss-Prot
Match: ACYP_NITWN (Acylphosphatase OS=Nitrobacter winogradskyi (strain Nb-255 / ATCC 25391) GN=acyP PE=3 SV=1)

HSP 1 Score: 69.3218 bits (168), Expect = 6.746e-12
Identity = 33/64 (51.56%), Postives = 44/64 (68.75%), Query Frame = 1
Query:    1 RGVFYRNWTIENATQLGLKGWVRNRRDGSVEALFSGNPDSVKEMEQRCCHGPSDAVVTGLQVFP 192
            +GV +R WT+  A + G+ GWVRNRRDGSVEALF+G+ ++V EM  RC  GP  A V  ++  P
Sbjct:   15 QGVGFRYWTMREAIRFGVGGWVRNRRDGSVEALFAGSTEAVAEMITRCRSGPEFARVDDIEDQP 78          
BLAST of CX300211 vs. ExPASy Swiss-Prot
Match: ACYP_BRAJA (Acylphosphatase OS=Bradyrhizobium japonicum GN=acyP PE=3 SV=1)

HSP 1 Score: 68.9366 bits (167), Expect = 8.810e-12
Identity = 33/57 (57.89%), Postives = 39/57 (68.42%), Query Frame = 1
Query:    1 RGVFYRNWTIENATQLGLKGWVRNRRDGSVEALFSGNPDSVKEMEQRCCHGPSDAVV 171
            +GV YR W    AT  GL+GWVRNRRDGSVEALF+G P+ V +M   C HGP  + V
Sbjct:   15 QGVGYRAWVEYQATASGLEGWVRNRRDGSVEALFAGAPNHVADMVALCRHGPPSSRV 71          
BLAST of CX300211 vs. ExPASy Swiss-Prot
Match: ACYP_RHOPB (Acylphosphatase OS=Rhodopseudomonas palustris (strain BisB18) GN=acyP PE=3 SV=1)

HSP 1 Score: 68.1662 bits (165), Expect = 1.503e-11
Identity = 36/68 (52.94%), Postives = 45/68 (66.18%), Query Frame = 1
Query:    1 RGVFYRNWTIENATQLGLKGWVRNRRDGSVEALFSGNPDSVKEMEQRCCHGPSDAVVTGLQVFPSNDD 204
            +GV YR +    A +L L+GWVRNRRDGSVEALF+G  ++V E+  RC  GPS A VT L   P + D
Sbjct:   15 QGVGYRAFVEYQAMKLDLEGWVRNRRDGSVEALFAGPAEAVAEIIARCRRGPSSARVTKLDEQPGSVD 82          
The following BLAST results are available for this feature:
BLAST of CX300211 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 7
Match NameE-valueIdentityDescription
ACYP_SPHWW2.097e-1348.78Acylphosphatase OS=Sphingomonas wittichii (strain ... [more]
ACYP_RHOFD3.577e-1351.47Acylphosphatase OS=Rhodoferax ferrireducens (strai... [more]
ACYP_RHORT7.969e-1348.10Acylphosphatase OS=Rhodospirillum rubrum (strain A... [more]
ACYP_NITHX1.041e-1253.13Acylphosphatase OS=Nitrobacter hamburgensis (strai... [more]
ACYP_NITWN6.746e-1251.56Acylphosphatase OS=Nitrobacter winogradskyi (strai... [more]
ACYP_BRAJA8.810e-1257.89Acylphosphatase OS=Bradyrhizobium japonicum GN=acy... [more]
ACYP_RHOPB1.503e-1152.94Acylphosphatase OS=Rhodopseudomonas palustris (str... [more]
back to top
Libraries
Library NameType
SaltLeaf1cdna_library
Properties
Property NameValue
Genbank descriptionC07007E04SK SaltLeaf1 Citrus clementina cDNA clone C07007E04, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CX300211 ID=CX300211|Name=CX300211|organism=Citrus clementina|type=EST|length=392bp
AGGGGTGTGTTCTACAGGAACTGGACCATAGAGAATGCCACACAATTAGG
GTTGAAAGGTTGGGTGCGGAACAGGCGTGATGGTTCTGTAGAGGCTCTGT
TTTCAGGGAACCCTGATTCTGTCAAGGAGATGGAGCAGAGGTGCTGCCAT
GGCCCATCAGATGCTGTAGTTACAGGGCTCCAGGTCTTCCCATCCAATGA
TGATCCTGGTACGGGATTTGTGCGCAAACAAACTGTTTGATCAAACTCTG
CGTATAGATTACTACTGGTTTCCACTTTAATCATGTATACTGCATTCCTT
TATACAAGTATTACAATAAACTCTCTTGAGGAATTATATCTGATGTACCC
GCAGTCGCTTCTTTATCTTGTTGGACTACGTGTTACTGGATG
back to top