CX300212

Overview
NameCX300212
Unique NameCX300212
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length417
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of CX300212 vs. ExPASy Swiss-Prot
Match: RCA1_LARTR (Ribulose bisphosphate carboxylase/oxygenase activase 1, chloroplastic OS=Larrea tridentata GN=RCA1 PE=2 SV=1)

HSP 1 Score: 212.616 bits (540), Expect = 4.940e-55
Identity = 108/140 (77.14%), Postives = 118/140 (84.29%), Query Frame = 3
Query:    3 KGIFRNDNVADDDIVKLVDTFPGQSIDFFGALRARVYDDEVRKWXXXXXXXXXXKSLVNSKEAAPTFEQPRMTMEKLLEYGNMIVQEQENVKRVQLADKYLSEAALGEANEDAIQSGNFY-GKAAQQM-NVPVPEGCTDP 416
            KGIFR DNVADDDIVKLVDTFPGQSIDFFGALRARVY DEVRKW          K LVNSKE  P+FEQP+MT++KLL YG M+VQEQENVKRVQLADKY+SEAALG+AN DAI+ G FY G+AAQQ+ NVPVPEGCTDP
Sbjct:  317 KGIFRTDNVADDDIVKLVDTFPGQSIDFFGALRARVYHDEVRKWVSEVGVDTIGKKLVNSKEGPPSFEQPKMTIDKLLGYGGMLVQEQENVKRVQLADKYMSEAALGDANNDAIKRGTFYGGQAAQQVGNVPVPEGCTDP 456          
BLAST of CX300212 vs. ExPASy Swiss-Prot
Match: RCA_ORYSJ (Ribulose bisphosphate carboxylase/oxygenase activase, chloroplastic OS=Oryza sativa subsp. japonica GN=RCA PE=1 SV=2)

HSP 1 Score: 206.838 bits (525), Expect = 2.711e-53
Identity = 100/139 (71.94%), Postives = 118/139 (84.89%), Query Frame = 3
Query:    3 KGIFRNDNVADDDIVKLVDTFPGQSIDFFGALRARVYDDEVRKWXXXXXXXXXXKSLVNSKEAAPTFEQPRMTMEKLLEYGNMIVQEQENVKRVQLADKYLSEAALGEANEDAIQSGNFYGKAAQQM-NVPVPEGCTDP 416
            KGIFR DNV D+DIVK+VD+FPGQSIDFFGALRARVYDDEVRKW          K LVNS+E  P FEQP+MT+EKL+EYG M+V+EQENVKRVQLA++YLSEAALG+AN DA+++G+FYG+ AQQ  N+PVPEGCTDP
Sbjct:  308 KGIFRTDNVPDEDIVKIVDSFPGQSIDFFGALRARVYDDEVRKWVSDTGVENIGKRLVNSREGPPEFEQPKMTIEKLMEYGYMLVKEQENVKRVQLAEQYLSEAALGDANSDAMKTGSFYGQGAQQAGNLPVPEGCTDP 446          
BLAST of CX300212 vs. ExPASy Swiss-Prot
Match: RCAA_HORVU (Ribulose bisphosphate carboxylase/oxygenase activase A, chloroplastic OS=Hordeum vulgare GN=RCAA PE=2 SV=1)

HSP 1 Score: 204.912 bits (520), Expect = 1.030e-52
Identity = 96/137 (70.07%), Postives = 117/137 (85.40%), Query Frame = 3
Query:    3 KGIFRNDNVADDDIVKLVDTFPGQSIDFFGALRARVYDDEVRKWXXXXXXXXXXKSLVNSKEAAPTFEQPRMTMEKLLEYGNMIVQEQENVKRVQLADKYLSEAALGEANEDAIQSGNFYGKAAQQMNVPVPEGCTD 413
            KGIF+ DNV+D+ +VK+VDTFPGQSIDFFGALRARVYDDEVRKW          K LVNS++   TFEQP+MT+EKLLEYG+M+VQEQ+NVKRVQLAD Y+S+AALG+AN+DA+++G+FYGK AQQ  +PVPEGCTD
Sbjct:  307 KGIFQTDNVSDESVVKIVDTFPGQSIDFFGALRARVYDDEVRKWVGSTGIENIGKRLVNSRDGPVTFEQPKMTVEKLLEYGHMLVQEQDNVKRVQLADTYMSQAALGDANQDAMKTGSFYGKGAQQGTLPVPEGCTD 443          
BLAST of CX300212 vs. ExPASy Swiss-Prot
Match: RCA_ARATH (Ribulose bisphosphate carboxylase/oxygenase activase, chloroplastic OS=Arabidopsis thaliana GN=RCA PE=1 SV=2)

HSP 1 Score: 202.986 bits (515), Expect = 3.914e-52
Identity = 99/138 (71.74%), Postives = 110/138 (79.71%), Query Frame = 3
Query:    3 KGIFRNDNVADDDIVKLVDTFPGQSIDFFGALRARVYDDEVRKWXXXXXXXXXXKSLVNSKEAAPTFEQPRMTMEKLLEYGNMIVQEQENVKRVQLADKYLSEAALGEANEDAIQSGNFYGKAAQQMNVPVPEGCTDP 416
            KGIFR D + D+DIV LVD FPGQSIDFFGALRARVYDDEVRK+          K LVNS+E  P FEQP MT EKL+EYGNM+V EQENVKRVQLA+ YLS+AALG+AN DAI  G FYGK AQQ+N+PVPEGCTDP
Sbjct:  317 KGIFRTDKIKDEDIVTLVDQFPGQSIDFFGALRARVYDDEVRKFVESLGVEKIGKRLVNSREGPPVFEQPEMTYEKLMEYGNMLVMEQENVKRVQLAETYLSQAALGDANADAIGRGTFYGKGAQQVNLPVPEGCTDP 454          
BLAST of CX300212 vs. ExPASy Swiss-Prot
Match: RCA_SPIOL (Ribulose bisphosphate carboxylase/oxygenase activase, chloroplastic OS=Spinacia oleracea PE=1 SV=2)

HSP 1 Score: 196.438 bits (498), Expect = 3.663e-50
Identity = 93/137 (67.88%), Postives = 110/137 (80.29%), Query Frame = 3
Query:    6 GIFRNDNVADDDIVKLVDTFPGQSIDFFGALRARVYDDEVRKWXXXXXXXXXXKSLVNSKEAAPTFEQPRMTMEKLLEYGNMIVQEQENVKRVQLADKYLSEAALGEANEDAIQSGNFYGKAAQQMNVPVPEGCTDP 416
            GIF+ D V  + +VKLVD FPGQSIDFFGALRARVY DEVRKW          K LVNSK+  P FEQP MT++KL+EYGNM+VQEQENVKRVQLAD+Y+S AALG+AN+DAI  G F+GKAAQQ+++PV +GCTDP
Sbjct:  316 GIFKTDKVPAEHVVKLVDAFPGQSIDFFGALRARVYHDEVRKWVNSVGVDNVGKKLVNSKDGPPVFEQPEMTLQKLMEYGNMLVQEQENVKRVQLADQYMSSAALGDANKDAIDRGTFFGKAAQQVSLPVAQGCTDP 452          
BLAST of CX300212 vs. ExPASy Swiss-Prot
Match: RCA_MALDO (Ribulose bisphosphate carboxylase/oxygenase activase, chloroplastic OS=Malus domestica GN=RCA PE=2 SV=1)

HSP 1 Score: 193.356 bits (490), Expect = 3.101e-49
Identity = 95/120 (79.17%), Postives = 103/120 (85.83%), Query Frame = 3
Query:    6 GIFRNDNVADDDIVKLVDTFPGQSIDFFGALRARVYDDEVRKWXXXXXXXXXXKSLVNSKEAAPTFEQPRMTMEKLLEYGNMIVQEQENVKRVQLADKYLSEAALGEANEDAIQSGNFYG 365
            GIFR+DNVA +DIVKLVDTFPGQSIDFFGALRARVYDDEVRKW          K LVNSKE  PTFEQP+MT+EKLLEYGNM+VQEQENVKRVQLADKYLSEAALG+AN DA+ +G FYG
Sbjct:  318 GIFRSDNVAKEDIVKLVDTFPGQSIDFFGALRARVYDDEVRKWITGVGVDSIGKKLVNSKEGPPTFEQPKMTIEKLLEYGNMLVQEQENVKRVQLADKYLSEAALGDANSDAMNTGTFYG 437          
BLAST of CX300212 vs. ExPASy Swiss-Prot
Match: RCAB_HORVU (Ribulose bisphosphate carboxylase/oxygenase activase B, chloroplastic OS=Hordeum vulgare GN=RCAB PE=2 SV=1)

HSP 1 Score: 187.963 bits (476), Expect = 1.303e-47
Identity = 90/122 (73.77%), Postives = 105/122 (86.07%), Query Frame = 3
Query:    3 KGIFRNDNVADDDIVKLVDTFPGQSIDFFGALRARVYDDEVRKWXXXXXXXXXXKSLVNSKEAAPTFEQPRMTMEKLLEYGNMIVQEQENVKRVQLADKYLSEAALGEANEDAIQSGNFYGK 368
            KGIFR DNV D+ +V+LVDTFPGQSIDFFGALRARVYDDEVRKW          K LVNS+E  PTF+QP+MT+EKL+EYG+M+VQEQENVKRVQLADKYLSEAALG+AN+DA+++G FYGK
Sbjct:  304 KGIFRTDNVPDEAVVRLVDTFPGQSIDFFGALRARVYDDEVRKWVGEIGVENISKRLVNSREGPPTFDQPKMTIEKLMEYGHMLVQEQENVKRVQLADKYLSEAALGQANDDAMKTGAFYGK 425          
BLAST of CX300212 vs. ExPASy Swiss-Prot
Match: RCA_PHAAU (Ribulose bisphosphate carboxylase/oxygenase activase, chloroplastic OS=Phaseolus aureus GN=RCA PE=2 SV=2)

HSP 1 Score: 184.882 bits (468), Expect = 1.103e-46
Identity = 89/120 (74.17%), Postives = 102/120 (85.00%), Query Frame = 3
Query:    3 KGIFRNDNVADDDIVKLVDTFPGQSIDFFGALRARVYDDEVRKWXXXXXXXXXXKSLVNSKEAAPTFEQPRMTMEKLLEYGNMIVQEQENVKRVQLADKYLSEAALGEANEDAIQSGNFY 362
            KGIFR D V ++DI KLVDTFPGQSIDFFGALRARVYDDEVRKW          K LVNSKE  PTF+QP+M+++KLL+YGNM+VQEQENVKRVQLADKYL+EAALG ANEDAI+SG+F+
Sbjct:  319 KGIFRTDGVPEEDITKLVDTFPGQSIDFFGALRARVYDDEVRKWISGVGVDATGKKLVNSKEGPPTFDQPKMSLDKLLQYGNMLVQEQENVKRVQLADKYLNEAALGNANEDAIKSGSFF 438          
BLAST of CX300212 vs. ExPASy Swiss-Prot
Match: RCA2_LARTR (Ribulose bisphosphate carboxylase/oxygenase activase 2, chloroplastic OS=Larrea tridentata GN=RCA2 PE=2 SV=1)

HSP 1 Score: 182.956 bits (463), Expect = 4.192e-46
Identity = 88/119 (73.95%), Postives = 101/119 (84.87%), Query Frame = 3
Query:    3 KGIFRNDNVADDDIVKLVDTFPGQSIDFFGALRARVYDDEVRKWXXXXXXXXXXKSLVNSKEAAPTFEQPRMTMEKLLEYGNMIVQEQENVKRVQLADKYLSEAALGEANEDAIQSGNF 359
            KGIFR DNV ++DIVK+VD FPGQSIDFFGALRARVYDDEVRKW          K LVNSKE  PTFEQP+MT++KLL+YGNM+V+EQENVKRVQLADKY+SEAALG+AN+DAI+ G F
Sbjct:  317 KGIFRTDNVPEEDIVKVVDQFPGQSIDFFGALRARVYDDEVRKWVSEVGVDTIGKKLVNSKEGPPTFEQPKMTIDKLLQYGNMLVEEQENVKRVQLADKYMSEAALGDANQDAIKRGTF 435          
BLAST of CX300212 vs. ExPASy Swiss-Prot
Match: RCA_MAIZE (Ribulose bisphosphate carboxylase/oxygenase activase, chloroplastic OS=Zea mays GN=RCA1 PE=2 SV=3)

HSP 1 Score: 177.563 bits (449), Expect = 1.761e-44
Identity = 85/120 (70.83%), Postives = 102/120 (85.00%), Query Frame = 3
Query:    3 KGIFRNDNVADDDIVKLVDTFPGQSIDFFGALRARVYDDEVRKWXXXXXXXXXXKSLVNSKEAAPTFEQPRMTMEKLLEYGNMIVQEQENVKRVQLADKYLSEAALGEANEDAIQSGNFY 362
            KGIFR D V ++ +V+LVDTFPGQSIDFFGALRARVYDDEVR+W          + LVNSKE  PTFEQP++T+EKLLEYG+M+V EQENVKRVQLADKYL+EAALGEANEDA+++G+F+
Sbjct:  313 KGIFRTDGVDEEHVVQLVDTFPGQSIDFFGALRARVYDDEVRRWVSETGVENIARKLVNSKEGPPTFEQPKITIEKLLEYGHMLVAEQENVKRVQLADKYLNEAALGEANEDAMKTGSFF 432          
The following BLAST results are available for this feature:
BLAST of CX300212 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 18
Match NameE-valueIdentityDescription
RCA1_LARTR4.940e-5577.14Ribulose bisphosphate carboxylase/oxygenase activa... [more]
RCA_ORYSJ2.711e-5371.94Ribulose bisphosphate carboxylase/oxygenase activa... [more]
RCAA_HORVU1.030e-5270.07Ribulose bisphosphate carboxylase/oxygenase activa... [more]
RCA_ARATH3.914e-5271.74Ribulose bisphosphate carboxylase/oxygenase activa... [more]
RCA_SPIOL3.663e-5067.88Ribulose bisphosphate carboxylase/oxygenase activa... [more]
RCA_MALDO3.101e-4979.17Ribulose bisphosphate carboxylase/oxygenase activa... [more]
RCAB_HORVU1.303e-4773.77Ribulose bisphosphate carboxylase/oxygenase activa... [more]
RCA_PHAAU1.103e-4674.17Ribulose bisphosphate carboxylase/oxygenase activa... [more]
RCA2_LARTR4.192e-4673.95Ribulose bisphosphate carboxylase/oxygenase activa... [more]
RCA_MAIZE1.761e-4470.83Ribulose bisphosphate carboxylase/oxygenase activa... [more]

Pages

back to top
Libraries
Library NameType
SaltLeaf1cdna_library
Properties
Property NameValue
Genbank descriptionC07007E06SK SaltLeaf1 Citrus clementina cDNA clone C07007E06, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CX300212 ID=CX300212|Name=CX300212|organism=Citrus clementina|type=EST|length=417bp
GCAAGGGTATCTTCAGGAATGACAATGTGGCTGATGACGACATTGTCAAG
CTTGTCGACACCTTCCCCGGCCAATCCATTGATTTCTTTGGAGCCCTGAG
GGCCAGAGTCTATGATGATGAGGTGAGGAAGTGGATCTCTGGTGTTGGTG
TTGGAAGCATTGGCAAGAGCCTTGTGAACTCAAAGGAAGCAGCCCCAACA
TTCGAGCAACCAAGGATGACAATGGAGAAGCTGCTCGAGTACGGAAACAT
GATTGTGCAAGAGCAAGAGAATGTGAAGAGAGTTCAGTTGGCTGACAAGT
ATTTGAGTGAGGCCGCTCTTGGTGAAGCTAATGAAGATGCTATTCAGAGT
GGAAATTTCTATGGCAAAGCAGCCCAGCAAATGAATGTTCCAGTTCCTGA
AGGATGTACTGATCCTA
back to top