CX305130
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Alignments
Homology
BLAST of CX305130 vs. ExPASy Swiss-Prot
Match: PPA1_SOLLC (Acid phosphatase 1 OS=Solanum lycopersicum GN=APS1 PE=2 SV=1) HSP 1 Score: 89.3521 bits (220), Expect = 6.307e-18 Identity = 41/52 (78.85%), Postives = 45/52 (86.54%), Query Frame = 2 Query: 8 GKLAIIYKSEKRNEMVQEGYRILGNSGDQWSDLLGSPMPSRSFKLPNPMYYI 163 GK A YKSE+RN MV+EG+RI+GNSGDQWSDLLGS M RSFKLPNPMYYI Sbjct: 203 GKTATTYKSERRNAMVEEGFRIVGNSGDQWSDLLGSSMSYRSFKLPNPMYYI 254
BLAST of CX305130 vs. ExPASy Swiss-Prot
Match: VSP1_ARATH (Vegetative storage protein 1 OS=Arabidopsis thaliana GN=VSP1 PE=2 SV=2) HSP 1 Score: 68.1662 bits (165), Expect = 1.505e-11 Identity = 28/49 (57.14%), Postives = 39/49 (79.59%), Query Frame = 2 Query: 20 IIYKSEKRNEMVQEGYRILGNSGDQWSDLLGSPMPSRSFKLPNPMYYIP 166 ++YKS+ RN +V++GY I+GN GDQW+DL+ P R FKLPNP+YY+P Sbjct: 222 VVYKSKVRNSLVKKGYNIVGNIGDQWADLV-EDTPGRVFKLPNPLYYVP 269
BLAST of CX305130 vs. ExPASy Swiss-Prot
Match: VSP2_ARATH (Vegetative storage protein 2 OS=Arabidopsis thaliana GN=VSP2 PE=1 SV=1) HSP 1 Score: 65.855 bits (159), Expect = 7.468e-11 Identity = 27/49 (55.10%), Postives = 38/49 (77.55%), Query Frame = 2 Query: 20 IIYKSEKRNEMVQEGYRILGNSGDQWSDLLGSPMPSRSFKLPNPMYYIP 166 ++YKS+ R +V++GY I+GN GDQW+DL+ P R FKLPNP+YY+P Sbjct: 217 VVYKSKVRKSLVKKGYNIVGNIGDQWADLV-EDTPGRVFKLPNPLYYVP 264 The following BLAST results are available for this feature:
BLAST of CX305130 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 3
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >CX305130 ID=CX305130; Name=CX305130; organism=Citrus clementina; type=EST; length=415bpback to top |