CX305273

Overview
NameCX305273
Unique NameCX305273
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length375
Libraries
Library NameType
Drought1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of CX305273 vs. ExPASy Swiss-Prot
Match: ASP_THECC (21 kDa seed protein OS=Theobroma cacao GN=ASP PE=2 SV=1)

HSP 1 Score: 97.8265 bits (242), Expect = 1.753e-20
Identity = 49/102 (48.04%), Postives = 68/102 (66.67%), Query Frame = -2
Query:   75 STDLNLGFSVLLSGRD-YCNEQPLWKVDNYDAASGKWFITTGGLDGHPGAETLLNWFKLEKIGNFPGTYKIVHCPSVCESCVKLCNNVGR-SFEDGVRRLVL 374
            STD+N+ F  +   RD  C+   +W++DNYD ++GKW++TT G+ G PG  TL +WFK+EK G     YK   CPSVC+SC  LC+++GR S +DG  RL L
Sbjct:  101 STDVNIEFVPI---RDRLCSTSTVWRLDNYDNSAGKWWVTTDGVKGEPGPNTLCSWFKIEKAGVL--GYKFRFCPSVCDSCTTLCSDIGRHSDDDGQIRLAL 197          
BLAST of CX305273 vs. ExPASy Swiss-Prot
Match: MIRA_RICDU (Miraculin OS=Richadella dulcifica PE=1 SV=3)

HSP 1 Score: 90.5077 bits (223), Expect = 2.798e-18
Identity = 44/108 (40.74%), Postives = 66/108 (61.11%), Query Frame = -2
Query:   51 STDLNLGFSVLLSGRDYCNEQPLWKVDNYDAASGKWFITTGGLDGHPGAETLLNWFKLEKIGNFPGTYKIVHCPSVCESCVKLCNNVGRSFEDGVRRLVLVRDDEPAF 374
            STDLN+ FS  +  R       +W++D YD ++G++F+T GG+ G+PG ET+ +WFK+E+     G YK+V CP+VC SC   C +VG   +   RR + + D   AF
Sbjct:  108 STDLNINFSAFMPCR--WTSSTVWRLDKYDESTGQYFVTIGGVKGNPGPETISSWFKIEEFCG-SGFYKLVFCPTVCGSCKVKCGDVGIYIDQKGRRRLALSDKPFAF 212          
BLAST of CX305273 vs. ExPASy Swiss-Prot
Match: LSPI_CARPA (Latex serine proteinase inhibitor OS=Carica papaya PE=1 SV=1)

HSP 1 Score: 68.1662 bits (165), Expect = 1.487e-11
Identity = 40/104 (38.46%), Postives = 58/104 (55.77%), Query Frame = -2
Query:   66 STDLNLGFSVLLSGRDYCNEQPLWKVDNYDAASGKWFITTGGLDGHPGAETLLNWFKLEKIGNFPGTYKIVHCPSVCESCVKLCNNVGRSFED-GVRRLVLVRD 374
            S DLN+ F++ ++    CNE   WKVD +    G W +T GG  G+ G E+  + FK++K G  P +YK   CPS   + +  CNNV   F+   +RRL+L  D
Sbjct:   76 SVDLNVKFNITIN----CNETTAWKVDRFPGVIG-WTVTLGGEKGYHGFESTHSMFKIKKAG-LPFSYKFHFCPSYPRTRLIPCNNVDIFFDKYRIRRLILTND 173          
The following BLAST results are available for this feature:
BLAST of CX305273 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 3
Match NameE-valueIdentityDescription
ASP_THECC1.753e-2048.0421 kDa seed protein OS=Theobroma cacao GN=ASP PE=2... [more]
MIRA_RICDU2.798e-1840.74Miraculin OS=Richadella dulcifica PE=1 SV=3[more]
LSPI_CARPA1.487e-1138.46Latex serine proteinase inhibitor OS=Carica papaya... [more]
back to top
Properties
Property NameValue
Genbank descriptionC18003E04Rv Drought1 Citrus clementina cDNA clone C18003E04, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CX305273 ID=CX305273; Name=CX305273; organism=Citrus clementina; type=EST; length=375bp
ATTGATTACACAGACGTTGATCTTTCTGTAGCGGGAATTAACACAACAGG
AAATGCCGGCTCATCATCACGAACCAGAACCAGACGTCGAACGCCATCCT
CAAACGAACGGCCAACGTTGTTGCAGAGTTTGACACAAGACTCGCAAACG
GATGGACAATGAACGATTTTGTATGTACCTGGAAAATTTCCAATTTTCTC
AAGCTTAAACCAATTTAGCAAAGTTTCAGCTCCAGGGTGACCATCAAGTC
CCCCGGTTGTTATAAACCATTTGCCTGATGCCGCGTCATAATTATCAACT
TTCCACAACGGTTGTTCGTTACAATAGTCACGTCCAGATAGCAACACTGA
GAATCCCAAGTTGAGATCAGTGGAT
back to top