CX308600

Overview
NameCX308600
Unique NameCX308600
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length294
Libraries
Library NameType
AbsLeaSub1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig123 contig Ccv1_Contig123:205..498. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CX308600 vs. ExPASy Swiss-Prot
Match: RS15A_BRANA (40S ribosomal protein S15a OS=Brassica napus GN=RPS15A PE=2 SV=3)

HSP 1 Score: 171.785 bits (434), Expect = 9.831e-43
Identity = 82/83 (98.80%), Postives = 83/83 (100.00%), Query Frame = -3
Query:   44 GEFEYVDDHRAGKIVVELNGRLNKCGVISPRFDVGVKEIEGWTARLLPSRQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY 292
            GEFEYVDDHR+GKIVVELNGRLNKCGVISPRFDVGVKEIEGWTARLLPSRQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY
Sbjct:   48 GEFEYVDDHRSGKIVVELNGRLNKCGVISPRFDVGVKEIEGWTARLLPSRQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY 130          
BLAST of CX308600 vs. ExPASy Swiss-Prot
Match: R15A1_ARATH (40S ribosomal protein S15a-1 OS=Arabidopsis thaliana GN=RPS15AA PE=2 SV=2)

HSP 1 Score: 171.785 bits (434), Expect = 9.831e-43
Identity = 82/83 (98.80%), Postives = 83/83 (100.00%), Query Frame = -3
Query:   44 GEFEYVDDHRAGKIVVELNGRLNKCGVISPRFDVGVKEIEGWTARLLPSRQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY 292
            GEFEYVDDHR+GKIVVELNGRLNKCGVISPRFDVGVKEIEGWTARLLPSRQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY
Sbjct:   48 GEFEYVDDHRSGKIVVELNGRLNKCGVISPRFDVGVKEIEGWTARLLPSRQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY 130          
BLAST of CX308600 vs. ExPASy Swiss-Prot
Match: R15A4_ARATH (40S ribosomal protein S15a-4 OS=Arabidopsis thaliana GN=RPS15AD PE=2 SV=3)

HSP 1 Score: 170.244 bits (430), Expect = 2.860e-42
Identity = 81/83 (97.59%), Postives = 83/83 (100.00%), Query Frame = -3
Query:   44 GEFEYVDDHRAGKIVVELNGRLNKCGVISPRFDVGVKEIEGWTARLLPSRQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY 292
            GEFEYVDDHR+GKIVVELNGRLNKCGVISPRFDVGVKEIEGWTARLLPSRQFG+IVLTTSAGIMDHEEARRKNVGGKVLGFFY
Sbjct:   48 GEFEYVDDHRSGKIVVELNGRLNKCGVISPRFDVGVKEIEGWTARLLPSRQFGFIVLTTSAGIMDHEEARRKNVGGKVLGFFY 130          
BLAST of CX308600 vs. ExPASy Swiss-Prot
Match: RS15A_DAUCA (40S ribosomal protein S15a OS=Daucus carota GN=RPS15A PE=2 SV=3)

HSP 1 Score: 168.703 bits (426), Expect = 8.322e-42
Identity = 81/83 (97.59%), Postives = 82/83 (98.80%), Query Frame = -3
Query:   44 GEFEYVDDHRAGKIVVELNGRLNKCGVISPRFDVGVKEIEGWTARLLPSRQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY 292
            GEFEYVDDHR+GKIVVELNGRLNKCGVISPRFDVGVKEIE WTARLLPSRQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY
Sbjct:   48 GEFEYVDDHRSGKIVVELNGRLNKCGVISPRFDVGVKEIEPWTARLLPSRQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY 130          
BLAST of CX308600 vs. ExPASy Swiss-Prot
Match: R15A3_ARATH (40S ribosomal protein S15a-3 OS=Arabidopsis thaliana GN=RPS15AC PE=2 SV=2)

HSP 1 Score: 162.925 bits (411), Expect = 4.567e-40
Identity = 76/82 (92.68%), Postives = 81/82 (98.78%), Query Frame = -3
Query:   44 EFEYVDDHRAGKIVVELNGRLNKCGVISPRFDVGVKEIEGWTARLLPSRQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY 289
            EFEYVDDHR+GKIVVELNGRLN CGVISPR+D+GVKEIEGWTA+LLPSRQFGYIVLTTSAGIMDHEEAR+KNVGGKVLGFFY
Sbjct:   49 EFEYVDDHRSGKIVVELNGRLNNCGVISPRYDLGVKEIEGWTAKLLPSRQFGYIVLTTSAGIMDHEEARKKNVGGKVLGFFY 130          
BLAST of CX308600 vs. ExPASy Swiss-Prot
Match: RS15A_STRPU (40S ribosomal protein S15a OS=Strongylocentrotus purpuratus GN=RPS15A PE=2 SV=3)

HSP 1 Score: 147.517 bits (371), Expect = 1.985e-35
Identity = 67/83 (80.72%), Postives = 75/83 (90.36%), Query Frame = -3
Query:   44 GEFEYVDDHRAGKIVVELNGRLNKCGVISPRFDVGVKEIEGWTARLLPSRQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY 292
            GEFE VDDHR GKI+V LNGRLNKCGVISPRFDV + E+E WT+ LLPSRQFGY+VLTTS GIMDHEEARRK+VGGK+LGFF+
Sbjct:   48 GEFEIVDDHRGGKIIVNLNGRLNKCGVISPRFDVPINEMEKWTSNLLPSRQFGYVVLTTSGGIMDHEEARRKHVGGKILGFFF 130          
BLAST of CX308600 vs. ExPASy Swiss-Prot
Match: RS22_CANGA (40S ribosomal protein S22 OS=Candida glabrata GN=RPS22 PE=3 SV=3)

HSP 1 Score: 146.747 bits (369), Expect = 3.387e-35
Identity = 66/83 (79.52%), Postives = 77/83 (92.77%), Query Frame = -3
Query:   44 GEFEYVDDHRAGKIVVELNGRLNKCGVISPRFDVGVKEIEGWTARLLPSRQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY 292
            GEFEY+DDHR+GKIVV+LNGRLNKCGVISPRF+V + +IE WTA LLP+RQFGY++LTTSAGIMDHEEARRK+V GK+LGF Y
Sbjct:   48 GEFEYIDDHRSGKIVVQLNGRLNKCGVISPRFNVKIGDIEKWTANLLPARQFGYVILTTSAGIMDHEEARRKHVSGKILGFVY 130          
BLAST of CX308600 vs. ExPASy Swiss-Prot
Match: RS22B_YEAST (40S ribosomal protein S22-B OS=Saccharomyces cerevisiae GN=RPS22B PE=1 SV=3)

HSP 1 Score: 146.747 bits (369), Expect = 3.387e-35
Identity = 66/83 (79.52%), Postives = 77/83 (92.77%), Query Frame = -3
Query:   44 GEFEYVDDHRAGKIVVELNGRLNKCGVISPRFDVGVKEIEGWTARLLPSRQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY 292
            GEFEY+DDHR+GKIVV+LNGRLNKCGVISPRF+V + +IE WTA LLP+RQFGY++LTTSAGIMDHEEARRK+V GK+LGF Y
Sbjct:   48 GEFEYIDDHRSGKIVVQLNGRLNKCGVISPRFNVKIGDIEKWTANLLPARQFGYVILTTSAGIMDHEEARRKHVSGKILGFVY 130          
BLAST of CX308600 vs. ExPASy Swiss-Prot
Match: RS22A_YEAST (40S ribosomal protein S22-A OS=Saccharomyces cerevisiae GN=RPS22A PE=1 SV=2)

HSP 1 Score: 146.747 bits (369), Expect = 3.387e-35
Identity = 66/83 (79.52%), Postives = 77/83 (92.77%), Query Frame = -3
Query:   44 GEFEYVDDHRAGKIVVELNGRLNKCGVISPRFDVGVKEIEGWTARLLPSRQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY 292
            GEFEY+DDHR+GKIVV+LNGRLNKCGVISPRF+V + +IE WTA LLP+RQFGY++LTTSAGIMDHEEARRK+V GK+LGF Y
Sbjct:   48 GEFEYIDDHRSGKIVVQLNGRLNKCGVISPRFNVKIGDIEKWTANLLPARQFGYVILTTSAGIMDHEEARRKHVSGKILGFVY 130          
BLAST of CX308600 vs. ExPASy Swiss-Prot
Match: RS15A_PARLI (40S ribosomal protein S15a OS=Paracentrotus lividus GN=RPS15A PE=2 SV=2)

HSP 1 Score: 146.362 bits (368), Expect = 4.423e-35
Identity = 66/83 (79.52%), Postives = 75/83 (90.36%), Query Frame = -3
Query:   44 GEFEYVDDHRAGKIVVELNGRLNKCGVISPRFDVGVKEIEGWTARLLPSRQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY 292
            GEFE VDDHR GKI+V LNGRLNKCGVISPRFDV + ++E WT+ LLPSRQFGY+VLTTS GIMDHEEARRK+VGGK+LGFF+
Sbjct:   48 GEFEVVDDHRGGKIIVNLNGRLNKCGVISPRFDVPINDMEKWTSNLLPSRQFGYVVLTTSGGIMDHEEARRKHVGGKILGFFF 130          
The following BLAST results are available for this feature:
BLAST of CX308600 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 97
Match NameE-valueIdentityDescription
RS15A_BRANA9.831e-4398.8040S ribosomal protein S15a OS=Brassica napus GN=RP... [more]
R15A1_ARATH9.831e-4398.8040S ribosomal protein S15a-1 OS=Arabidopsis thalia... [more]
R15A4_ARATH2.860e-4297.5940S ribosomal protein S15a-4 OS=Arabidopsis thalia... [more]
RS15A_DAUCA8.322e-4297.5940S ribosomal protein S15a OS=Daucus carota GN=RPS... [more]
R15A3_ARATH4.567e-4092.6840S ribosomal protein S15a-3 OS=Arabidopsis thalia... [more]
RS15A_STRPU1.985e-3580.7240S ribosomal protein S15a OS=Strongylocentrotus p... [more]
RS22_CANGA3.387e-3579.5240S ribosomal protein S22 OS=Candida glabrata GN=R... [more]
RS22B_YEAST3.387e-3579.5240S ribosomal protein S22-B OS=Saccharomyces cerev... [more]
RS22A_YEAST3.387e-3579.5240S ribosomal protein S22-A OS=Saccharomyces cerev... [more]
RS15A_PARLI4.423e-3579.5240S ribosomal protein S15a OS=Paracentrotus lividu... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC21001G03Rv AbsLeaSub1 Citrus clementina cDNA clone C21001G03, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CX308600 ID=CX308600|Name=CX308600|organism=Citrus clementina|type=EST|length=294bp
ACAAACAAAACTCAAGTCCCATTCTCAATATGAACTTTGCCTAGTAGAAA
AAACCAAGCACTTTACCACCAACATTCTTCCTTCTCGCCTCTTCGTGGTC
CATAATGCCAGCAGAAGTTGTCAGCACAATGTATCCAAACTGTCTTGAGG
GAAGCAACCTAGCAGTCCAACCTTCAATCTCCTTGACGCCAACATCAAAA
CGGGGACTGATAACCCCACATTTGTTCAATCTTCCGTTCAGTTCAACCAC
AATCTTACCAGCTCTGTGGTCATCAACATACTCAAACTCACCAA
back to top