CX308744
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of CX308744 vs. ExPASy Swiss-Prot
Match: URM12_ARATH (Ubiquitin-related modifier 1 homolog 2 OS=Arabidopsis thaliana GN=URM1-2 PE=3 SV=1) HSP 1 Score: 79.337 bits (194), Expect = 6.494e-15 Identity = 38/52 (73.08%), Postives = 43/52 (82.69%), Query Frame = -1 Query: 1 CDSVKVHNVDVVPPKGSEKLIMKDLLSWVGTNLIKERPEMFMKGDSVRPGVL 156 CDSVK+H V++ S+ L MKDLLSWV TNLIKERPEMFMKGD+VRPGVL Sbjct: 15 CDSVKIHKVNINLLNDSDILTMKDLLSWVRTNLIKERPEMFMKGDTVRPGVL 66
BLAST of CX308744 vs. ExPASy Swiss-Prot
Match: URM1_ORYSJ (Ubiquitin-related modifier 1 homolog OS=Oryza sativa subsp. japonica GN=URM1 PE=3 SV=1) HSP 1 Score: 75.485 bits (184), Expect = 9.377e-14 Identity = 35/50 (70.00%), Postives = 41/50 (82.00%), Query Frame = -1 Query: 1 SVKVHNVDVVPPKGSEKLIMKDLLSWVGTNLIKERPEMFMKGDSVRPGVL 150 S KVH VD+ P G K++MK LL+WV +NLIKERPEMF+KGDSVRPGVL Sbjct: 18 STKVHKVDLQPNDGDGKVVMKGLLAWVKSNLIKERPEMFLKGDSVRPGVL 67
BLAST of CX308744 vs. ExPASy Swiss-Prot
Match: URM1_ORYSI (Ubiquitin-related modifier 1 homolog OS=Oryza sativa subsp. indica GN=URM1 PE=3 SV=1) HSP 1 Score: 75.485 bits (184), Expect = 9.377e-14 Identity = 35/50 (70.00%), Postives = 41/50 (82.00%), Query Frame = -1 Query: 1 SVKVHNVDVVPPKGSEKLIMKDLLSWVGTNLIKERPEMFMKGDSVRPGVL 150 S KVH VD+ P G K++MK LL+WV +NLIKERPEMF+KGDSVRPGVL Sbjct: 18 STKVHKVDLQPNDGDGKVVMKGLLAWVKSNLIKERPEMFLKGDSVRPGVL 67
BLAST of CX308744 vs. ExPASy Swiss-Prot
Match: URM11_ARATH (Ubiquitin-related modifier 1 homolog 1 OS=Arabidopsis thaliana GN=URM1-1 PE=3 SV=2) HSP 1 Score: 75.485 bits (184), Expect = 9.377e-14 Identity = 38/54 (70.37%), Postives = 42/54 (77.78%), Query Frame = -1 Query: 1 CDSVKVHNVDVVPPKG--SEKLIMKDLLSWVGTNLIKERPEMFMKGDSVRPGVL 156 CDS K+H V+V P G S+ MK LLSWV TNLIKERPEMFMKGD+VRPGVL Sbjct: 15 CDSEKIHKVNVDLPNGADSDDFTMKHLLSWVRTNLIKERPEMFMKGDTVRPGVL 68
BLAST of CX308744 vs. ExPASy Swiss-Prot
Match: URM1_MAIZE (Ubiquitin-related modifier 1 homolog OS=Zea mays GN=URM1 PE=3 SV=1) HSP 1 Score: 70.0922 bits (170), Expect = 3.940e-12 Identity = 36/52 (69.23%), Postives = 40/52 (76.92%), Query Frame = -1 Query: 1 DSVKVHNVDVVPPK-GSEKLIMKDLLSWVGTNLIKERPEMFMKGDSVRPGVL 153 +S KVH V+V PK G K+ MK LLSWV NLIKERPEMF+K DSVRPGVL Sbjct: 17 NSTKVHKVEVTTPKDGQGKVTMKFLLSWVKENLIKERPEMFLKADSVRPGVL 68 The following BLAST results are available for this feature:
BLAST of CX308744 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 5
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >CX308744 ID=CX308744; Name=CX308744; organism=Citrus clementina; type=EST; length=279bpback to top |