CX308896

Overview
NameCX308896
Unique NameCX308896
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length446
Libraries
Library NameType
AbsLeaSub1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig632 contig Ccv1_Contig632:350..796. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CX308896 vs. ExPASy Swiss-Prot
Match: RS202_ARATH (40S ribosomal protein S20-2 OS=Arabidopsis thaliana GN=RPS20B PE=2 SV=1)

HSP 1 Score: 89.7373 bits (221), Expect = 5.725e-18
Identity = 44/44 (100.00%), Postives = 44/44 (100.00%), Query Frame = -2
Query:  311 TWDRFELRVHKRVIDLFSSPDVVKQITSITIEPGVEVEVTIADS 442
            TWDRFELRVHKRVIDLFSSPDVVKQITSITIEPGVEVEVTIADS
Sbjct:   79 TWDRFELRVHKRVIDLFSSPDVVKQITSITIEPGVEVEVTIADS 122          
BLAST of CX308896 vs. ExPASy Swiss-Prot
Match: RS201_ARATH (40S ribosomal protein S20-1 OS=Arabidopsis thaliana GN=RPS20A PE=1 SV=2)

HSP 1 Score: 89.7373 bits (221), Expect = 5.725e-18
Identity = 44/44 (100.00%), Postives = 44/44 (100.00%), Query Frame = -2
Query:  311 TWDRFELRVHKRVIDLFSSPDVVKQITSITIEPGVEVEVTIADS 442
            TWDRFELRVHKRVIDLFSSPDVVKQITSITIEPGVEVEVTIADS
Sbjct:   81 TWDRFELRVHKRVIDLFSSPDVVKQITSITIEPGVEVEVTIADS 124          
BLAST of CX308896 vs. ExPASy Swiss-Prot
Match: RS20_ORYSJ (40S ribosomal protein S20 OS=Oryza sativa subsp. japonica GN=RPS20 PE=2 SV=2)

HSP 1 Score: 80.4925 bits (197), Expect = 3.473e-15
Identity = 39/43 (90.70%), Postives = 41/43 (95.35%), Query Frame = -2
Query:  314 TWDRFELRVHKRVIDLFSSPDVVKQITSITIEPGVEVEVTIAD 442
            TWDRFE+RVHKRVIDL SS DVVKQITSITIEPGVEVEVTI+D
Sbjct:   85 TWDRFEMRVHKRVIDLVSSADVVKQITSITIEPGVEVEVTISD 127          
BLAST of CX308896 vs. ExPASy Swiss-Prot
Match: RS20_XENLA (40S ribosomal protein S20 OS=Xenopus laevis GN=rps20 PE=3 SV=1)

HSP 1 Score: 73.9442 bits (180), Expect = 3.251e-13
Identity = 33/44 (75.00%), Postives = 41/44 (93.18%), Query Frame = -2
Query:  311 TWDRFELRVHKRVIDLFSSPDVVKQITSITIEPGVEVEVTIADS 442
            TWDRF++R+HKR+IDL S  ++VKQITSI+IEPGVEVEVTIAD+
Sbjct:   76 TWDRFQMRIHKRLIDLHSPSEIVKQITSISIEPGVEVEVTIADA 119          
BLAST of CX308896 vs. ExPASy Swiss-Prot
Match: RS20_RAT (40S ribosomal protein S20 OS=Rattus norvegicus GN=Rps20 PE=3 SV=1)

HSP 1 Score: 73.9442 bits (180), Expect = 3.251e-13
Identity = 33/44 (75.00%), Postives = 41/44 (93.18%), Query Frame = -2
Query:  311 TWDRFELRVHKRVIDLFSSPDVVKQITSITIEPGVEVEVTIADS 442
            TWDRF++R+HKR+IDL S  ++VKQITSI+IEPGVEVEVTIAD+
Sbjct:   76 TWDRFQMRIHKRLIDLHSPSEIVKQITSISIEPGVEVEVTIADA 119          
BLAST of CX308896 vs. ExPASy Swiss-Prot
Match: RS20_PONAB (40S ribosomal protein S20 OS=Pongo abelii GN=RPS20 PE=3 SV=1)

HSP 1 Score: 73.9442 bits (180), Expect = 3.251e-13
Identity = 33/44 (75.00%), Postives = 41/44 (93.18%), Query Frame = -2
Query:  311 TWDRFELRVHKRVIDLFSSPDVVKQITSITIEPGVEVEVTIADS 442
            TWDRF++R+HKR+IDL S  ++VKQITSI+IEPGVEVEVTIAD+
Sbjct:   76 TWDRFQMRIHKRLIDLHSPSEIVKQITSISIEPGVEVEVTIADA 119          
BLAST of CX308896 vs. ExPASy Swiss-Prot
Match: RS20_MOUSE (40S ribosomal protein S20 OS=Mus musculus GN=Rps20 PE=1 SV=1)

HSP 1 Score: 73.9442 bits (180), Expect = 3.251e-13
Identity = 33/44 (75.00%), Postives = 41/44 (93.18%), Query Frame = -2
Query:  311 TWDRFELRVHKRVIDLFSSPDVVKQITSITIEPGVEVEVTIADS 442
            TWDRF++R+HKR+IDL S  ++VKQITSI+IEPGVEVEVTIAD+
Sbjct:   76 TWDRFQMRIHKRLIDLHSPSEIVKQITSISIEPGVEVEVTIADA 119          
BLAST of CX308896 vs. ExPASy Swiss-Prot
Match: RS20_MACFA (40S ribosomal protein S20 OS=Macaca fascicularis GN=RPS20 PE=3 SV=1)

HSP 1 Score: 73.9442 bits (180), Expect = 3.251e-13
Identity = 33/44 (75.00%), Postives = 41/44 (93.18%), Query Frame = -2
Query:  311 TWDRFELRVHKRVIDLFSSPDVVKQITSITIEPGVEVEVTIADS 442
            TWDRF++R+HKR+IDL S  ++VKQITSI+IEPGVEVEVTIAD+
Sbjct:   76 TWDRFQMRIHKRLIDLHSPSEIVKQITSISIEPGVEVEVTIADA 119          
BLAST of CX308896 vs. ExPASy Swiss-Prot
Match: RS20_HUMAN (40S ribosomal protein S20 OS=Homo sapiens GN=RPS20 PE=1 SV=1)

HSP 1 Score: 73.9442 bits (180), Expect = 3.251e-13
Identity = 33/44 (75.00%), Postives = 41/44 (93.18%), Query Frame = -2
Query:  311 TWDRFELRVHKRVIDLFSSPDVVKQITSITIEPGVEVEVTIADS 442
            TWDRF++R+HKR+IDL S  ++VKQITSI+IEPGVEVEVTIAD+
Sbjct:   76 TWDRFQMRIHKRLIDLHSPSEIVKQITSISIEPGVEVEVTIADA 119          
BLAST of CX308896 vs. ExPASy Swiss-Prot
Match: RS20_BOVIN (40S ribosomal protein S20 OS=Bos taurus GN=RPS20 PE=3 SV=1)

HSP 1 Score: 73.9442 bits (180), Expect = 3.251e-13
Identity = 33/44 (75.00%), Postives = 41/44 (93.18%), Query Frame = -2
Query:  311 TWDRFELRVHKRVIDLFSSPDVVKQITSITIEPGVEVEVTIADS 442
            TWDRF++R+HKR+IDL S  ++VKQITSI+IEPGVEVEVTIAD+
Sbjct:   76 TWDRFQMRIHKRLIDLHSPSEIVKQITSISIEPGVEVEVTIADA 119          
The following BLAST results are available for this feature:
BLAST of CX308896 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 13
Match NameE-valueIdentityDescription
RS202_ARATH5.725e-18100.0040S ribosomal protein S20-2 OS=Arabidopsis thalian... [more]
RS201_ARATH5.725e-18100.0040S ribosomal protein S20-1 OS=Arabidopsis thalian... [more]
RS20_ORYSJ3.473e-1590.7040S ribosomal protein S20 OS=Oryza sativa subsp. j... [more]
RS20_XENLA3.251e-1375.0040S ribosomal protein S20 OS=Xenopus laevis GN=rps... [more]
RS20_RAT3.251e-1375.0040S ribosomal protein S20 OS=Rattus norvegicus GN=... [more]
RS20_PONAB3.251e-1375.0040S ribosomal protein S20 OS=Pongo abelii GN=RPS20... [more]
RS20_MOUSE3.251e-1375.0040S ribosomal protein S20 OS=Mus musculus GN=Rps20... [more]
RS20_MACFA3.251e-1375.0040S ribosomal protein S20 OS=Macaca fascicularis G... [more]
RS20_HUMAN3.251e-1375.0040S ribosomal protein S20 OS=Homo sapiens GN=RPS20... [more]
RS20_BOVIN3.251e-1375.0040S ribosomal protein S20 OS=Bos taurus GN=RPS20 P... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC21005C12Rv AbsLeaSub1 Citrus clementina cDNA clone C21005C12, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CX308896 ID=CX308896; Name=CX308896; organism=Citrus clementina; type=EST; length=446bp
TTTTTTTTTTTTTTTTTTTTTTTTTGGGGGAAAACATATGATATTAACGT
CTATTAGAGATTCAAAACAAATATCCAAACATTGCTTAATATAAAATGAA
CAGTAAACAAAATCCCTCTCCACATAACCCAAAACATAATTTTTAACTTG
CAAAATAGTATGACAAAAAACAAACTAACATCAACCCTACATCGATTGTT
CAGTCTTAAATTCTTGACAAATTCTTCCAAGCAAACAGTGTCATGAGGGA
AGATTACTTCTGATTTCACTAAAAGCTAAATGGACACAAAAATAAAGTGC
CAGACATTTAAGAGTCGGCAATGGTAACCTCCACTTCCACGCCAGGTTCA
ATGGTAATGGAAGTGATCTGCTTCACGACATCAGGGGAGCTAAAGAGATC
AATAACTCTCTTGTGAACACGGAGCTCAAATCTGTCCCAAGTCCCG
back to top