CX309112

Overview
NameCX309112
Unique NameCX309112
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length410
Libraries
Library NameType
AbsLeaSub1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of CX309112 vs. ExPASy Swiss-Prot
Match: GUN2_PERAE (Endoglucanase 2 (Fragment) OS=Persea americana GN=CEL2 PE=2 SV=1)

HSP 1 Score: 96.6709 bits (239), Expect = 3.982e-20
Identity = 43/58 (74.14%), Postives = 50/58 (86.21%), Query Frame = 1
Query:    1 YSRSPNPNVLSGAILGGPDNTDNFADDRNNYQQSEPATYINAPFVGAVAFFSSKTTTN 174
            YS SPNPN+L GAILGGPD+ D+F+DDRNNYQQSEPATYINAP VGA+AFF++    N
Sbjct:   73 YSSSPNPNILVGAILGGPDSRDSFSDDRNNYQQSEPATYINAPLVGALAFFAANPVAN 130          
BLAST of CX309112 vs. ExPASy Swiss-Prot
Match: GUN1_PERAE (Endoglucanase 1 OS=Persea americana GN=CEL1 PE=2 SV=1)

HSP 1 Score: 96.2857 bits (238), Expect = 5.201e-20
Identity = 43/57 (75.44%), Postives = 49/57 (85.96%), Query Frame = 1
Query:    1 YSRSPNPNVLSGAILGGPDNTDNFADDRNNYQQSEPATYINAPFVGAVAFFSSKTTT 171
            YS  PNPN+L GAILGGPDN D+F+DDRNNYQQSEPATYINAP VGA+AFF++   T
Sbjct:  437 YSSPPNPNILVGAILGGPDNRDSFSDDRNNYQQSEPATYINAPLVGALAFFAANPVT 493          
BLAST of CX309112 vs. ExPASy Swiss-Prot
Match: GUN19_ORYSJ (Endoglucanase 19 OS=Oryza sativa subsp. japonica GN=Os08g0114200 PE=2 SV=1)

HSP 1 Score: 83.5741 bits (205), Expect = 3.489e-16
Identity = 37/55 (67.27%), Postives = 45/55 (81.82%), Query Frame = 1
Query:    1 YSRSPNPNVLSGAILGGPDNTDNFADDRNNYQQSEPATYINAPFVGAVAFFSSKT 165
            +S  PNPNVL GA++GGPD+ D FADDR N+ QSEPATYINAP VGA+A+F+  T
Sbjct:  468 HSGEPNPNVLVGAVVGGPDSRDAFADDRGNFAQSEPATYINAPLVGALAYFAGTT 522          
BLAST of CX309112 vs. ExPASy Swiss-Prot
Match: GUN17_ARATH (Endoglucanase 17 OS=Arabidopsis thaliana GN=At4g02290 PE=2 SV=1)

HSP 1 Score: 78.5666 bits (192), Expect = 1.122e-14
Identity = 33/51 (64.71%), Postives = 44/51 (86.27%), Query Frame = 1
Query:    4 SRSPNPNVLSGAILGGPDNTDNFADDRNNYQQSEPATYINAPFVGAVAFFS 156
            S+SPNPN L GA++GGPD  D F D+R++Y+QSEPATYIN+P VGA+A+F+
Sbjct:  460 SQSPNPNFLVGAVVGGPDQHDRFPDERSDYEQSEPATYINSPLVGALAYFA 510          
BLAST of CX309112 vs. ExPASy Swiss-Prot
Match: GUN9_ARATH (Endoglucanase 9 OS=Arabidopsis thaliana GN=CEL3 PE=1 SV=1)

HSP 1 Score: 75.0998 bits (183), Expect = 1.241e-13
Identity = 30/57 (52.63%), Postives = 46/57 (80.70%), Query Frame = 1
Query:    1 YSRSPNPNVLSGAILGGPDNTDNFADDRNNYQQSEPATYINAPFVGAVAFFSSKTTT 171
            Y+++PNPN+L+GAI+GGP+  D + D R++Y  +EPATYINA FVG +A+F++  +T
Sbjct:  428 YTQNPNPNILTGAIVGGPNQNDGYPDQRDDYSHAEPATYINAAFVGPLAYFAAGRST 484          
BLAST of CX309112 vs. ExPASy Swiss-Prot
Match: GUN1_ARATH (Endoglucanase 1 OS=Arabidopsis thaliana GN=CEL2 PE=2 SV=1)

HSP 1 Score: 74.3294 bits (181), Expect = 2.117e-13
Identity = 32/51 (62.75%), Postives = 42/51 (82.35%), Query Frame = 1
Query:    4 SRSPNPNVLSGAILGGPDNTDNFADDRNNYQQSEPATYINAPFVGAVAFFS 156
            S+SPNPN L GA++GGPD  D F D+R++Y +SEPATYINAP VGA+A+ +
Sbjct:  449 SQSPNPNDLVGAVVGGPDQNDQFPDERSDYGRSEPATYINAPLVGALAYLA 499          
BLAST of CX309112 vs. ExPASy Swiss-Prot
Match: GUN3_ARATH (Endoglucanase 3 OS=Arabidopsis thaliana GN=CEL5 PE=2 SV=2)

HSP 1 Score: 72.4034 bits (176), Expect = 8.043e-13
Identity = 29/52 (55.77%), Postives = 44/52 (84.62%), Query Frame = 1
Query:    4 SRSPNPNVLSGAILGGPDNTDNFADDRNNYQQSEPATYINAPFVGAVAFFSS 159
            +++PNPN+L+GAI+GGP+  D + D R++Y +SEPATYINA FVG +A+F++
Sbjct:  429 TQNPNPNILTGAIVGGPNQNDEYPDQRDDYTRSEPATYINAAFVGPLAYFAA 480          
BLAST of CX309112 vs. ExPASy Swiss-Prot
Match: GUN24_ARATH (Endoglucanase 24 OS=Arabidopsis thaliana GN=At4g39010 PE=2 SV=1)

HSP 1 Score: 72.4034 bits (176), Expect = 8.043e-13
Identity = 30/52 (57.69%), Postives = 42/52 (80.77%), Query Frame = 1
Query:    4 SRSPNPNVLSGAILGGPDNTDNFADDRNNYQQSEPATYINAPFVGAVAFFSS 159
            S  PNPNVL GA++GGP   D + DDR+++++SEP TYINAPFVG +A+F++
Sbjct:  441 STEPNPNVLIGAVVGGPGEDDMYDDDRSDFRKSEPTTYINAPFVGVLAYFAA 492          
BLAST of CX309112 vs. ExPASy Swiss-Prot
Match: GUN8_ARATH (Endoglucanase 8 OS=Arabidopsis thaliana GN=CEL1 PE=2 SV=1)

HSP 1 Score: 72.0182 bits (175), Expect = 1.050e-12
Identity = 32/55 (58.18%), Postives = 42/55 (76.36%), Query Frame = 1
Query:    4 SRSPNPNVLSGAILGGPDNTDNFADDRNNYQQSEPATYINAPFVGAVAFFSSKTT 168
            S +PNPN+L GA++GGP+ TD F D R  +QQSEP TYINAP VG + +FS+ +T
Sbjct:  436 SPNPNPNLLVGAVVGGPNVTDAFPDSRPYFQQSEPTTYINAPLVGLLGYFSAHST 490          
BLAST of CX309112 vs. ExPASy Swiss-Prot
Match: GUN4_ORYSJ (Endoglucanase 4 OS=Oryza sativa subsp. japonica GN=GLU14 PE=2 SV=1)

HSP 1 Score: 71.2478 bits (173), Expect = 1.792e-12
Identity = 31/52 (59.62%), Postives = 42/52 (80.77%), Query Frame = 1
Query:    1 YSRSPNPNVLSGAILGGPDNTDNFADDRNNYQQSEPATYINAPFVGAVAFFS 156
            +S  P+ N+L+GA++GGPD  D FAD R+NY Q+EP+TY NAP VGA+AFF+
Sbjct:  444 HSPEPDRNLLAGAVVGGPDAGDAFADGRDNYAQAEPSTYTNAPLVGALAFFA 495          
The following BLAST results are available for this feature:
BLAST of CX309112 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 22
Match NameE-valueIdentityDescription
GUN2_PERAE3.982e-2074.14Endoglucanase 2 (Fragment) OS=Persea americana GN=... [more]
GUN1_PERAE5.201e-2075.44Endoglucanase 1 OS=Persea americana GN=CEL1 PE=2 S... [more]
GUN19_ORYSJ3.489e-1667.27Endoglucanase 19 OS=Oryza sativa subsp. japonica G... [more]
GUN17_ARATH1.122e-1464.71Endoglucanase 17 OS=Arabidopsis thaliana GN=At4g02... [more]
GUN9_ARATH1.241e-1352.63Endoglucanase 9 OS=Arabidopsis thaliana GN=CEL3 PE... [more]
GUN1_ARATH2.117e-1362.75Endoglucanase 1 OS=Arabidopsis thaliana GN=CEL2 PE... [more]
GUN3_ARATH8.043e-1355.77Endoglucanase 3 OS=Arabidopsis thaliana GN=CEL5 PE... [more]
GUN24_ARATH8.043e-1357.69Endoglucanase 24 OS=Arabidopsis thaliana GN=At4g39... [more]
GUN8_ARATH1.050e-1258.18Endoglucanase 8 OS=Arabidopsis thaliana GN=CEL1 PE... [more]
GUN4_ORYSJ1.792e-1259.62Endoglucanase 4 OS=Oryza sativa subsp. japonica GN... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC21008F11Rv AbsLeaSub1 Citrus clementina cDNA clone C21008F11, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CX309112 ID=CX309112|Name=CX309112|organism=Citrus clementina|type=EST|length=410bp
TACTCTAGATCACCCAATCCAAATGTTCTCAGTGGAGCTATATTAGGTGG
GCCTGATAATACAGACAATTTTGCCGATGATCGTAATAATTATCAGCAGT
CAGAACCAGCTACATACATCAATGCGCCGTTTGTTGGTGCTGTTGCTTTC
TTCTCATCCAAAACCACCACAAATTAACTAAAATGTTCTTTGTTTCTTTC
TTGAGGATTGGCGTGAATCTGTCTTATCCTGTGTGATGTGAGAATTTGAG
AAGTTTGGTTTACAATGCTTCCAATTCCACGTCAGAACTGTAACCTCTAA
TAATTCTTCTCTTGAGTTTTTGAGTAATATGGTAAGTAATATATCAATTA
TGGCAAAAGAGATATCTTTGCCAACTTTGAGCTAAANAAAAAAAAAAAAA
AAAAAAAAAA
back to top